#NEXUS [!This data set was downloaded from TreeBASE, a relational database of phylogenetic knowledge. TreeBASE has been supported by the NSF, Harvard University, Yale University, SDSC and UC Davis. Please do not remove this acknowledgment from the Nexus file. Generated on July 24, 2021; 11:42 GMT TreeBASE (cc) 1994-2008 Study reference: Kubo H. 2009. Isolation of madA homologs in Pilobolus crystallinus. Mycoscience, 50(5): 400-406. TreeBASE Study URI: http://purl.org/phylo/treebase/phylows/study/TB2:S10008] BEGIN TAXA; TITLE Taxa1; DIMENSIONS NTAX=17; TAXLABELS Arabidopsis_thaliana_PHOT1 Bipolaris_oryzae Coprinopsis_cinerea Gibberella_fujikuroi Hypocrea_jecorina Lentinula_edodes Mucor_circinelloides_MCWC1A Mucor_circinelloides_MCWC1B Mucor_circinelloides_MCWC1C Neurospora_crassa Phycomyces_blakesleeanus_MADA Phycomyces_blakesleeanus_WCOA Phycomyces_blakesleeanus_WCOB Pilobolus_crystallinus_PCMADA1 Pilobolus_crystallinus_PCMADA2 Pilobolus_crystallinus_PCMADA3 Tuber_borchii ; END; BEGIN CHARACTERS; [! TreeBASE Matrix URI: http://purl.org/phylo/treebase/phylows/matrix/TB2:M4411] TITLE PCMADA; LINK TAXA = Taxa1; DIMENSIONS NCHAR=124; FORMAT DATATYPE=Protein SYMBOLS= "A C D E F G H I K L M N P Q R S T V W Y" MISSING=- GAP= #; MATRIX [ 10 20 30 40 50 60 70 80 90 100 110 120 ] [ . . . . . . . . . . . . ] Arabidopsis_thaliana_PHOT1 QTFVVSDATKPDYPIMYASAGFFNMTGYTSKEVVGRNCRFLQGSG------------TDADELAKIRETLAAGNNYCGRILNYKKDGTSFWNLLTIAPIKDESGK-------VLKFIGMQVEVS Bipolaris_oryzae CAFVVCDAELDDIPIVYCSENFERLTGYTRHMILGRNCRFLQAPDGKVESGIKR-NYVDDDSVYYLKNMIENRAEAQISLINYRRGGQPFMNLLTMIPIAWEPGGK------TKFFIGFQVDLV Coprinopsis_cinerea CSFVVVDTRRQDHPIVYCSPSFLKLTGYPEDEVIGRNCRFLQSPTGKMEQGEPRPDPATQTAAAQMKKCLNADKECQLVLTNYRKDGTPFTNLVTVIPIPGGLTGAAHEENEVVFHVGFQVDMT Gibberella_fujikuroi CAFVVCDVSMNDCPIIYVSDNFQNLTGYSRHEIVGQNCRFLQAPDGKVEAGSKR-EFVDDGAVYNLKKMVHEGREVQQSLINYRKGGKPFLNLLTMIPIPWD-TDE------IRYFIGFQIDLV Hypocrea_jecorina CAFVVCDVTMNDCPIIYVSDNFQNLTGYSRHEIMGQNCRFLQAPDGKVEAGSKR-EFVDDGAVYNLKRMIQEGREVQQSLINYRKGGKPFLNLLTMIPIPWD-TDE------IRYFIGFQIDLV Lentinula_edodes SSFVVIDVRRYDNPIIYCSRSFCRLTGYEEHEVIGKNCRFLQSPNGVQPKGEYR-RFTSNEAVSYLKKHLVADKECQTSIINYRKSGDAFINLVTVIPIKGGDISSPHEDDKVIYHVGFQVDLT Mucor_circinelloides_MCWC1A CSFLVTDARQYDCPIVYCSPTFENLTGYLANEIVGRNCRFLQAPDGQVTCGSRR-TYTDNQAVYHLKAQMLQNKEHQASIINYRKGGQPFVNLITVIPICNDNNE-------VAFFVGLQVDLV Mucor_circinelloides_MCWC1B CSFVVVDAKQYDFPLVYASPMFERLTGYAPSEVIGRNCRFLQAPDGRVAIGSRR-KYTDNTTVYHIKTHMVQGKESQSSIINYRKTGQPFVNLLTVIPIAWESSED------IDYFIGLQVDLV Mucor_circinelloides_MCWC1C CSFVVSDARQYDCPVIYCSPAFERLTGYTNNEIVGKNCRFLQSPDGQVTCGSRR-QHTDNQAVYHLKAQLNQGKEHQASIINYRKGGQPFVNLVTVIPILGDNGQ-------VDYFVGLQVDLV Neurospora_crassa CAFVVCDVTLNDCPIIYVSDNFQNLTGYSRHEIVGRNCRFLQAPDGNVEAGTKR-EFVENNAVYTLKKTIAEGQEIQQSLINYRKGGKPFLNLLTMIPIPWD-TEE------IRYFIGFQIDLV Phycomyces_blakesleeanus_MADA CSFLVTDARQYDHPIVYCSPTFEHLTGYKGSEILGRNCRFLQAPDGRVTSGSRR-QHTDNQAVYHLKAQMLQSNEHQASIINYRKGGQAFVNLITVIPICNEFNE-------VAFFVGLQVDLV Phycomyces_blakesleeanus_WCOA CSFLVSDARQYDCPIIYCSPAFETLTGYSSNEILGKNCRFLQAPDGLVTGGSRR-RHTDNQAVYHLKAQLIQNREHQASIINYRKGGQAFVNLITVIPLLDNQGE-------VAYYVGLQVDLV Phycomyces_blakesleeanus_WCOB CSFVVVDAHQYDAPIVYASPTFEKLTGYTPSEVVGRNCRFLQAPDGRVALGSRR-KYTDNTAVCHIKTHISQGKESQASLINYRKTGQPFVNLLTVIPVAWESDE-------IDYFVGLQVDLV Pilobolus_crystallinus_PCMADA1 CSFLVTDARQYDCPIVYCSPTFEHLTGYHANEIVGRNCRFLQAPDGQVTCGSRR-TYTDNQAVFHLKAQMLQNKEHQASIINYRKGGQPFVNLITVIPITNDNNE-------VAFFVGLQVDLV Pilobolus_crystallinus_PCMADA2 CSFVVVDARQYDFPLVYVSPVFEKLTGYSPADVMGKNCRFLQSPDGHVAIGSRR-KYTDNTTVYHIKTHMVQGKESQSSIINYRKTGQPFVNLLTVIPISWDSDE-------IDYFMGLQVDLV Pilobolus_crystallinus_PCMADA3 CAFVVSDAKQYDMPIIYCSPAFERLTGYTNKEIVGKNCRFLQSPDGKVTCGSRR-QHTDNQAVYHIKGQINQGKEHQASIINYRKDGQPFVNLVTVIPLWDENNT-------IELFVGLQVDLV Tuber_borchii CSFVVTDARKFDNPIVYCSATFERLTGYTKHEILGRNCRFLQAPDAKIVPGVKR-KYVDDDAVYYLKNQIQAKKEAQTSLINYRKGGQPFTNLLTMIPITWD-SPE------VVYFVGFQVDLV ; END; BEGIN TREES; TITLE Tb10448; LINK TAXA = Taxa1; TRANSLATE 1 Coprinopsis_cinerea, 2 Lentinula_edodes, 3 Hypocrea_jecorina, 4 Gibberella_fujikuroi, 5 Neurospora_crassa, 6 Bipolaris_oryzae, 7 Tuber_borchii, 8 Mucor_circinelloides_MCWC1A, 9 Pilobolus_crystallinus_PCMADA1, 10 Phycomyces_blakesleeanus_MADA, 11 Phycomyces_blakesleeanus_WCOA, 12 Pilobolus_crystallinus_PCMADA3, 13 Mucor_circinelloides_MCWC1C, 14 Mucor_circinelloides_MCWC1B, 15 Pilobolus_crystallinus_PCMADA2, 16 Phycomyces_blakesleeanus_WCOB, 17 Arabidopsis_thaliana_PHOT1; TREE Fig._3 = [&R] (((1,2),(((((3,4),5),6),7),((((8,9),10),(11,(12,13))),((14,15),16)))),17); END;