#NEXUS [!This data set was downloaded from TreeBASE, a relational database of phylogenetic knowledge. TreeBASE has been supported by the NSF, Harvard University, Yale University, SDSC and UC Davis. Please do not remove this acknowledgment from the Nexus file. Generated on January 22, 2022; 6:34 GMT TreeBASE (cc) 1994-2008 Study reference: Singh R.K., Gase K., Baldwin I.T., & Pandey S.P. 2015. Molecular evolution and diversification of the Argonaute family of proteins in plants. BMC Plant Biology, . TreeBASE Study URI: http://purl.org/phylo/treebase/phylows/study/TB2:S16716] BEGIN TAXA; TITLE Taxa1; DIMENSIONS NTAX=302; TAXLABELS Aedes_aegypti_AaAGO2 Amphimedon_queenslandica_AqAGO2like1 Amphimedon_queenslandica_AqAGO2like2 Anopheles_darlingi_AdAGO2 Arabidopsis_lyrata_AlAGO1 Arabidopsis_lyrata_AlAGO10 Arabidopsis_lyrata_AlAGO2 Arabidopsis_lyrata_AlAGO3 Arabidopsis_lyrata_AlAGO4 Arabidopsis_lyrata_AlAGO5 Arabidopsis_lyrata_AlAGO6 Arabidopsis_lyrata_AlAGO7 Arabidopsis_lyrata_AlAGO8 Arabidopsis_lyrata_AlAGO9 Arabidopsis_thaliana_AtAGO1 Arabidopsis_thaliana_AtAGO10 Arabidopsis_thaliana_AtAGO2 Arabidopsis_thaliana_AtAGO3 Arabidopsis_thaliana_AtAGO4 Arabidopsis_thaliana_AtAGO5 Arabidopsis_thaliana_AtAGO6 Arabidopsis_thaliana_AtAGO7 Arabidopsis_thaliana_AtAGO8 Arabidopsis_thaliana_AtAGO9 Arabidopsis_thaliana_AtAGOlike Bombyx_mori_BmoAGO1 Bombyx_mori_BmoAGO2 Bos_taurus_BtAGO2 Brachypodium_distachyon_BdAGO12like Brachypodium_distachyon_BdAGO16like Brachypodium_distachyon_BdAGO18like Brachypodium_distachyon_BdAGO1Alike Brachypodium_distachyon_BdAGO1Blike Brachypodium_distachyon_BdAGO1Clike Brachypodium_distachyon_BdAGO1Dlike Brachypodium_distachyon_BdAGO2like Brachypodium_distachyon_BdAGO4Alike Brachypodium_distachyon_BdAGO4Blike Brachypodium_distachyon_BdAGO7like Brachypodium_distachyon_BdMEL1like Brachypodium_distachyon_BdMELlike Brachypodium_distachyon_BdPNH1like Brassica_rapa_BrAGO1 Brassica_rapa_BrAGO10 Brassica_rapa_BrAGO2a Brassica_rapa_BrAGO2b Brassica_rapa_BrAGO4 Brassica_rapa_BrAGO5 Brassica_rapa_BrAGO6 Brassica_rapa_BrAGO7 Brassica_rapa_BrAGO9a Brassica_rapa_BrAGO9b Brassica_rapa_BrAGO9c Brugia_malayi_BmaAGO2 Capsella_rubella_CrbAGO1 Capsella_rubella_CrbAGO10 Capsella_rubella_CrbAGO2 Capsella_rubella_CrbAGO3 Capsella_rubella_CrbAGO4 Capsella_rubella_CrbAGO5 Capsella_rubella_CrbAGO6 Capsella_rubella_CrbAGO7 Capsella_rubella_CrbAGO8 Capsella_rubella_CrbAGO9 Carica_papaya_CpAGO1 Carica_papaya_CpAGO10 Carica_papaya_CpAGO2 Carica_papaya_CpAGO4 Carica_papaya_CpAGO5 Carica_papaya_CpAGO6 Carica_papaya_CpAGO7 Chlamydomonas_reinhardtii_CrnAGO2 Chlamydomonas_reinhardtii_CrnAGO2like Chlamydomonas_reinhardtii_CrnAGO6 Chlamydomonas_reinhardtii_CrnAGOlike Citrus_sinensis_CsnAGO1 Citrus_sinensis_CsnAGO10 Citrus_sinensis_CsnAGO4 Citrus_sinensis_CsnAGO5 Citrus_sinensis_CsnAGO6 Citrus_sinensis_CsnAGO7 Citrus_sinensis_CsnAGO9 Citrus_sinensis_CsnAGOlike Crassostrea_gigas_CgAGO2 Cucumis_sativus_CstAGO1a Cucumis_sativus_CstAGO1b Cucumis_sativus_CstAGO4 Danaus_plexippus_DpAGO1 Danio_rerio_DrAGO2 Drosophila_immigrans_DiAGO2 Drosophila_melanogaster_DmAGO1 Drosophila_melanogaster_DmAGO2 Drosophila_santomea_DsAGO2 Ephydatia_fluviatilis_EfAGO Eucalyptus_grandis_EgAGO1 Eucalyptus_grandis_EgAGO10a Eucalyptus_grandis_EgAGO10b Eucalyptus_grandis_EgAGO4a Eucalyptus_grandis_EgAGO4b Eucalyptus_grandis_EgAGO4c Eucalyptus_grandis_EgAGO7 Glycine_max_GmAGO10like Glycine_max_GmAGO16like Glycine_max_GmAGO2like1 Glycine_max_GmAGO2like2 Glycine_max_GmAGO4Blike Glycine_max_GmAGO4like Glycine_max_GmAGO5like2 Glycine_max_GmAGO7like Glycine_max_GmAGOlike1 Glycine_max_GmAGOlike2 Glycine_max_GmPNH1like1 Glycine_max_GmPNH1like2 Homo_sapiens_HsAGO2 Hordeum_vulgare_HvAGO10 Hordeum_vulgare_HvAGO1a Hordeum_vulgare_HvAGO1b Hordeum_vulgare_HvAGO3 Hordeum_vulgare_HvAGO5 Hydra_vulgaris_HyvAGO2like Isodiametrica_pulchra_IpPIWIlike2 Kluyveromyces_polysporus_YeastAGO Linum_usitatissimum_LuAGO1 Linum_usitatissimum_LuAGO10a Linum_usitatissimum_LuAGO10b Linum_usitatissimum_LuAGO4a Linum_usitatissimum_LuAGO4b Linum_usitatissimum_LuAGO5 Linum_usitatissimum_LuAGO6 Linum_usitatissimum_LuAGO7 Linum_usitatissimum_LuAGO9 Lotus_japonicus_LjAGO7 Malus_domestica_MdAGO10a Malus_domestica_MdAGO10b Malus_domestica_MdAGO10c Malus_domestica_MdAGO1a Malus_domestica_MdAGO1b Malus_domestica_MdAGO4 Malus_domestica_MdAGO5a Malus_domestica_MdAGO5b Malus_domestica_MdAGO7a Malus_domestica_MdAGO7b Malus_domestica_MdAGO9 Manihot_esculenta_MeAGO1 Manihot_esculenta_MeAGO10 Manihot_esculenta_MeAGO4 Manihot_esculenta_MeAGO5 Manihot_esculenta_MeAGO7a Manihot_esculenta_MeAGO7b Manihot_esculenta_MeAGOlike Marsupenaeus_japonicus_MjAGO2 Medicago_truncatula_MtAGO10 Medicago_truncatula_MtAGO2 Medicago_truncatula_MtAGO3 Medicago_truncatula_MtAGO4a Medicago_truncatula_MtAGO4b Medicago_truncatula_MtAGO4c Medicago_truncatula_MtAGO4d Medicago_truncatula_MtAGO4e Medicago_truncatula_MtAGO6 Medicago_truncatula_MtAGO7 Mimulus_guttatus_MgAGO1 Mimulus_guttatus_MgAGO10 Mimulus_guttatus_MgAGO4 Mimulus_guttatus_MgAGO5 Mimulus_guttatus_MgAGO6 Mimulus_guttatus_MgAGO7 Mimulus_guttatus_MgAGO9 Musca_domestica_MudAGO1like Nematostella_vectensis_NvAGO1 Nematostella_vectensis_NvAGO2 Nicotiana_attenuata_NaAGO10 Nicotiana_attenuata_NaAGO1a Nicotiana_attenuata_NaAGO1b Nicotiana_attenuata_NaAGO1c Nicotiana_attenuata_NaAGO2 Nicotiana_attenuata_NaAGO4a Nicotiana_attenuata_NaAGO4b Nicotiana_attenuata_NaAGO5 Nicotiana_attenuata_NaAGO7 Nicotiana_attenuata_NaAGO8 Nicotiana_attenuata_NaAGO9 Nicotiana_benthamiana_NbAGO1.1 Nicotiana_benthamiana_NbAGO1.2 Nicotiana_benthamiana_NbAGO4.1 Nicotiana_benthamiana_NbAGO4.2 Nicotiana_tabacum_NtAGO1 Nilaparvata_lugens_NlAGO1 Nilaparvata_lugens_NlAGO2 Oikopleura_dioica_OdAGO2 Oryza_sativa_OsAGO11 Oryza_sativa_OsAGO12 Oryza_sativa_OsAGO13 Oryza_sativa_OsAGO14 Oryza_sativa_OsAGO17 Oryza_sativa_OsAGO18 Oryza_sativa_OsAGO1A Oryza_sativa_OsAGO1B Oryza_sativa_OsAGO1C Oryza_sativa_OsAGO1D Oryza_sativa_OsAGO2 Oryza_sativa_OsAGO3 Oryza_sativa_OsAGO4A Oryza_sativa_OsAGO4B Oryza_sativa_OsMLE1 Oryza_sativa_OsPNH1 Oryza_sativa_OsSHL4 Pelargonium_hortorum_PhAGO4like Phaseolus_vulgaris_PvAGO1 Phaseolus_vulgaris_PvAGO10a Phaseolus_vulgaris_PvAGO10b Phaseolus_vulgaris_PvAGO4 Phaseolus_vulgaris_PvAGO7 Phaseolus_vulgaris_PvAGO9 Physcomitrella_patens_PptAGO1 Physcomitrella_patens_PptAGO10 Physcomitrella_patens_PptAGO5 Physcomitrella_patens_PptAGOlike1 Physcomitrella_patens_PptAGOlike2 Physcomitrella_patens_PptAGOlike3 Picea_glauca_PgAGO Pisum_sativum_PsAGO1 Pisum_sativum_PsAGO2 Populus_trichocarpa_PtAGO1 Populus_trichocarpa_PtAGO10 Populus_trichocarpa_PtAGO4a Populus_trichocarpa_PtAGO4b Populus_trichocarpa_PtAGO6 Populus_trichocarpa_PtAGO7 Populus_trichocarpa_PtAGOlike1 Populus_trichocarpa_PtAGOlike2 Populus_trichocarpa_PtAGOlike3 Prunus_persica_PprAGO10 Prunus_persica_PprAGO1a Prunus_persica_PprAGO1b Prunus_persica_PprAGO4a Prunus_persica_PprAGO4b Prunus_persica_PprAGO5 Prunus_persica_PprAGO7 Ricinus_communis_RcAGO1 Ricinus_communis_RcAGO10a Ricinus_communis_RcAGO10b Ricinus_communis_RcAGO4a Ricinus_communis_RcAGO4b Ricinus_communis_RcAGO5 Ricinus_communis_RcAGO6 Ricinus_communis_RcAGO7 Sarcophilus_harrissi_ShAGO2 Selaginella_moellendorfii_SmAGO10 Selaginella_moellendorfii_SmAGO1a Selaginella_moellendorfii_SmAGO1b Solanum_lycopersicum_SlAGO4a Solanum_lycopersicum_SlAGO4b Solanum_lycopersicum_SlAGOlike1 Solanum_lycopersicum_SlAGOlike2 Solanum_lycopersicum_SlAGOlike3 Sorghum_bicolor_SbAGO10a Sorghum_bicolor_SbAGO10b Sorghum_bicolor_SbAGO10c Sorghum_bicolor_SbAGO1a Sorghum_bicolor_SbAGO1b Sorghum_bicolor_SbAGO4 Sorghum_bicolor_SbAGO7 Spodoptera_litura_SplAGO1 Spodoptera_litura_SplAGO2 Strongylocentrotus_purpuratus_SpAGO1 Sus_scrofa_SsAGO2 Thellungiella_halophila_ThAGO1 Thellungiella_halophila_ThAGO10 Thellungiella_halophila_ThAGO2 Thellungiella_halophila_ThAGO4 Thellungiella_halophila_ThAGO5 Thellungiella_halophila_ThAGO6 Thellungiella_halophila_ThAGO7 Thellungiella_halophila_ThAGO8 Thellungiella_halophila_ThAGO9 Tribolium_castaneum_TcAGO1a Tribolium_castaneum_TcAGO1b Tribolium_castaneum_TcAGO2a Tribolium_castaneum_TcAGO2b Tribolium_castaneum_TcAGO3 Trichuris_trichiura_TtAGO2 Vitis_vinifera_VvAGO10like Vitis_vinifera_VvAGO16like Vitis_vinifera_VvAGO1Blike Vitis_vinifera_VvAGO1like Vitis_vinifera_VvAGO2like Vitis_vinifera_VvAGO4 Vitis_vinifera_VvAGO4Alike Vitis_vinifera_VvAGO5like Vitis_vinifera_VvAGO7like Vitis_vinifera_VvMEL1like Vitis_vinifera_VvPNH1 Volvox_carteri_VcAGOlike Xenopus_laevis_XlAGO2 Zea_mays_ZmAGO10a Zea_mays_ZmAGO10b Zea_mays_ZmAGO1a Zea_mays_ZmAGO1b Zea_mays_ZmAGO1c Zea_mays_ZmAGO1d Zea_mays_ZmAGO4 ; END; BEGIN TAXA; TITLE Taxa2; DIMENSIONS NTAX=270; TAXLABELS Arabidopsis_lyrata_AlAGO1 Arabidopsis_lyrata_AlAGO10 Arabidopsis_lyrata_AlAGO2 Arabidopsis_lyrata_AlAGO3 Arabidopsis_lyrata_AlAGO4 Arabidopsis_lyrata_AlAGO5 Arabidopsis_lyrata_AlAGO6 Arabidopsis_lyrata_AlAGO7 Arabidopsis_lyrata_AlAGO8 Arabidopsis_lyrata_AlAGO9 Arabidopsis_thaliana_AtAGO1 Arabidopsis_thaliana_AtAGO10 Arabidopsis_thaliana_AtAGO2 Arabidopsis_thaliana_AtAGO3 Arabidopsis_thaliana_AtAGO4 Arabidopsis_thaliana_AtAGO5 Arabidopsis_thaliana_AtAGO6 Arabidopsis_thaliana_AtAGO7 Arabidopsis_thaliana_AtAGO8 Arabidopsis_thaliana_AtAGO9 Arabidopsis_thaliana_AtAGOlike Brachypodium_distachyon_BdAGO12like Brachypodium_distachyon_BdAGO16like Brachypodium_distachyon_BdAGO18like Brachypodium_distachyon_BdAGO1Alike Brachypodium_distachyon_BdAGO1Blike Brachypodium_distachyon_BdAGO1Clike Brachypodium_distachyon_BdAGO1Dlike Brachypodium_distachyon_BdAGO2like Brachypodium_distachyon_BdAGO4Alike Brachypodium_distachyon_BdAGO4Blike Brachypodium_distachyon_BdAGO7like Brachypodium_distachyon_BdMEL1like Brachypodium_distachyon_BdMELlike Brachypodium_distachyon_BdPNH1like Brassica_rapa_BrAGO1 Brassica_rapa_BrAGO10 Brassica_rapa_BrAGO2a Brassica_rapa_BrAGO2b Brassica_rapa_BrAGO4 Brassica_rapa_BrAGO5 Brassica_rapa_BrAGO6 Brassica_rapa_BrAGO7 Brassica_rapa_BrAGO9a Brassica_rapa_BrAGO9b Brassica_rapa_BrAGO9c Capsella_rubella_CrbAGO1 Capsella_rubella_CrbAGO10 Capsella_rubella_CrbAGO2 Capsella_rubella_CrbAGO3 Capsella_rubella_CrbAGO4 Capsella_rubella_CrbAGO5 Capsella_rubella_CrbAGO6 Capsella_rubella_CrbAGO7 Capsella_rubella_CrbAGO8 Capsella_rubella_CrbAGO9 Carica_papaya_CpAGO1 Carica_papaya_CpAGO10 Carica_papaya_CpAGO2 Carica_papaya_CpAGO4 Carica_papaya_CpAGO5 Carica_papaya_CpAGO6 Carica_papaya_CpAGO7 Chlamydomonas_reinhardtii_CrnAGO2 Chlamydomonas_reinhardtii_CrnAGO2like Chlamydomonas_reinhardtii_CrnAGO6 Chlamydomonas_reinhardtii_CrnAGOlike Citrus_sinensis_CsnAGO1 Citrus_sinensis_CsnAGO10 Citrus_sinensis_CsnAGO4 Citrus_sinensis_CsnAGO5 Citrus_sinensis_CsnAGO6 Citrus_sinensis_CsnAGO7 Citrus_sinensis_CsnAGO9 Citrus_sinensis_CsnAGOlike Cucumis_sativus_CstAGO1a Cucumis_sativus_CstAGO1b Cucumis_sativus_CstAGO4 Eucalyptus_grandis_EgAGO1 Eucalyptus_grandis_EgAGO10a Eucalyptus_grandis_EgAGO10b Eucalyptus_grandis_EgAGO4a Eucalyptus_grandis_EgAGO4b Eucalyptus_grandis_EgAGO4c Eucalyptus_grandis_EgAGO7 Glycine_max_GmAGO10like Glycine_max_GmAGO16like Glycine_max_GmAGO2like1 Glycine_max_GmAGO2like2 Glycine_max_GmAGO4Blike Glycine_max_GmAGO4like Glycine_max_GmAGO5like2 Glycine_max_GmAGO7like Glycine_max_GmAGOlike1 Glycine_max_GmAGOlike2 Glycine_max_GmPNH1like1 Glycine_max_GmPNH1like2 Homo_sapiens_HsAGO2 Hordeum_vulgare_HvAGO10 Hordeum_vulgare_HvAGO1a Hordeum_vulgare_HvAGO1b Hordeum_vulgare_HvAGO3 Hordeum_vulgare_HvAGO5 Kluyveromyces_polysporus_YeastAGO Linum_usitatissimum_LuAGO1 Linum_usitatissimum_LuAGO10a Linum_usitatissimum_LuAGO10b Linum_usitatissimum_LuAGO4a Linum_usitatissimum_LuAGO4b Linum_usitatissimum_LuAGO5 Linum_usitatissimum_LuAGO6 Linum_usitatissimum_LuAGO7 Linum_usitatissimum_LuAGO9 Lotus_japonicus_LjAGO7 Malus_domestica_MdAGO10a Malus_domestica_MdAGO10b Malus_domestica_MdAGO10c Malus_domestica_MdAGO1a Malus_domestica_MdAGO1b Malus_domestica_MdAGO4 Malus_domestica_MdAGO5a Malus_domestica_MdAGO5b Malus_domestica_MdAGO7a Malus_domestica_MdAGO7b Malus_domestica_MdAGO9 Manihot_esculenta_MeAGO1 Manihot_esculenta_MeAGO10 Manihot_esculenta_MeAGO4 Manihot_esculenta_MeAGO5 Manihot_esculenta_MeAGO7a Manihot_esculenta_MeAGO7b Manihot_esculenta_MeAGOlike Medicago_truncatula_MtAGO10 Medicago_truncatula_MtAGO2 Medicago_truncatula_MtAGO3 Medicago_truncatula_MtAGO4a Medicago_truncatula_MtAGO4b Medicago_truncatula_MtAGO4c Medicago_truncatula_MtAGO4d Medicago_truncatula_MtAGO4e Medicago_truncatula_MtAGO6 Medicago_truncatula_MtAGO7 Mimulus_guttatus_MgAGO1 Mimulus_guttatus_MgAGO10 Mimulus_guttatus_MgAGO4 Mimulus_guttatus_MgAGO5 Mimulus_guttatus_MgAGO6 Mimulus_guttatus_MgAGO7 Mimulus_guttatus_MgAGO9 Nicotiana_attenuata_NaAGO10 Nicotiana_attenuata_NaAGO1a Nicotiana_attenuata_NaAGO1b Nicotiana_attenuata_NaAGO1c Nicotiana_attenuata_NaAGO2 Nicotiana_attenuata_NaAGO4a Nicotiana_attenuata_NaAGO4b Nicotiana_attenuata_NaAGO5 Nicotiana_attenuata_NaAGO7 Nicotiana_attenuata_NaAGO8 Nicotiana_attenuata_NaAGO9 Nicotiana_benthamiana_NbAGO1.1 Nicotiana_benthamiana_NbAGO1.2 Nicotiana_benthamiana_NbAGO4.1 Nicotiana_benthamiana_NbAGO4.2 Nicotiana_tabacum_NtAGO1 Oryza_sativa_OsAGO11 Oryza_sativa_OsAGO12 Oryza_sativa_OsAGO13 Oryza_sativa_OsAGO14 Oryza_sativa_OsAGO17 Oryza_sativa_OsAGO18 Oryza_sativa_OsAGO1A Oryza_sativa_OsAGO1B Oryza_sativa_OsAGO1C Oryza_sativa_OsAGO1D Oryza_sativa_OsAGO2 Oryza_sativa_OsAGO3 Oryza_sativa_OsAGO4A Oryza_sativa_OsAGO4B Oryza_sativa_OsMLE1 Oryza_sativa_OsPNH1 Oryza_sativa_OsSHL4 Pelargonium_hortorum_PhAGO4like Phaseolus_vulgaris_PvAGO1 Phaseolus_vulgaris_PvAGO10a Phaseolus_vulgaris_PvAGO10b Phaseolus_vulgaris_PvAGO4 Phaseolus_vulgaris_PvAGO7 Phaseolus_vulgaris_PvAGO9 Physcomitrella_patens_PptAGO1 Physcomitrella_patens_PptAGO10 Physcomitrella_patens_PptAGO5 Physcomitrella_patens_PptAGOlike1 Physcomitrella_patens_PptAGOlike2 Physcomitrella_patens_PptAGOlike3 Picea_glauca_PgAGO Pisum_sativum_PsAGO1 Pisum_sativum_PsAGO2 Populus_trichocarpa_PtAGO1 Populus_trichocarpa_PtAGO10 Populus_trichocarpa_PtAGO4a Populus_trichocarpa_PtAGO4b Populus_trichocarpa_PtAGO6 Populus_trichocarpa_PtAGO7 Populus_trichocarpa_PtAGOlike1 Populus_trichocarpa_PtAGOlike2 Populus_trichocarpa_PtAGOlike3 Prunus_persica_PprAGO10 Prunus_persica_PprAGO1a Prunus_persica_PprAGO1b Prunus_persica_PprAGO4a Prunus_persica_PprAGO4b Prunus_persica_PprAGO5 Prunus_persica_PprAGO7 Ricinus_communis_RcAGO1 Ricinus_communis_RcAGO10a Ricinus_communis_RcAGO10b Ricinus_communis_RcAGO4a Ricinus_communis_RcAGO4b Ricinus_communis_RcAGO5 Ricinus_communis_RcAGO6 Ricinus_communis_RcAGO7 Selaginella_moellendorfii_SmAGO10 Selaginella_moellendorfii_SmAGO1a Selaginella_moellendorfii_SmAGO1b Solanum_lycopersicum_SlAGO4a Solanum_lycopersicum_SlAGO4b Solanum_lycopersicum_SlAGOlike1 Solanum_lycopersicum_SlAGOlike2 Solanum_lycopersicum_SlAGOlike3 Sorghum_bicolor_SbAGO10a Sorghum_bicolor_SbAGO10b Sorghum_bicolor_SbAGO10c Sorghum_bicolor_SbAGO1a Sorghum_bicolor_SbAGO1b Sorghum_bicolor_SbAGO4 Sorghum_bicolor_SbAGO7 Thellungiella_halophila_ThAGO1 Thellungiella_halophila_ThAGO10 Thellungiella_halophila_ThAGO2 Thellungiella_halophila_ThAGO4 Thellungiella_halophila_ThAGO5 Thellungiella_halophila_ThAGO6 Thellungiella_halophila_ThAGO7 Thellungiella_halophila_ThAGO8 Thellungiella_halophila_ThAGO9 Tribolium_castaneum_TcAGO1a Tribolium_castaneum_TcAGO1b Tribolium_castaneum_TcAGO2a Tribolium_castaneum_TcAGO2b Tribolium_castaneum_TcAGO3 Vitis_vinifera_VvAGO10like Vitis_vinifera_VvAGO16like Vitis_vinifera_VvAGO1Blike Vitis_vinifera_VvAGO1like Vitis_vinifera_VvAGO2like Vitis_vinifera_VvAGO4 Vitis_vinifera_VvAGO4Alike Vitis_vinifera_VvAGO5like Vitis_vinifera_VvAGO7like Vitis_vinifera_VvMEL1like Vitis_vinifera_VvPNH1 Volvox_carteri_VcAGOlike Zea_mays_ZmAGO10a Zea_mays_ZmAGO10b Zea_mays_ZmAGO1a Zea_mays_ZmAGO1b Zea_mays_ZmAGO1c Zea_mays_ZmAGO1d Zea_mays_ZmAGO4 ; END; BEGIN CHARACTERS; [! TreeBASE Matrix URI: http://purl.org/phylo/treebase/phylows/matrix/TB2:M25073] TITLE Plant_AGOs; LINK TAXA = Taxa2; DIMENSIONS NCHAR=621; FORMAT DATATYPE=Protein SYMBOLS= "A C D E F G H I K L M N P Q R S T V W Y" MISSING=? GAP= -; MATRIX [ 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 210 220 230 240 250 260 270 280 290 300 310 320 330 340 350 360 370 380 390 400 410 420 430 440 450 460 470 480 490 500 510 520 530 540 550 560 570 580 590 600 610 620 ] [ . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ] Arabidopsis_lyrata_AlAGO1 R-PGKGQGKRC-VVKANHFFAELVMKQLVDSYRESHLGNRAYDGRKSLYTA-GPL-PVVIK-LV-A-RADLPQEALQVLD-IVLRELPTSGRSFYSP-DIGSLGDGLRGFYQSIRPTQGLSLNIMS-STAFIESPVIKFVIKKALRGVKVRKYRISGLTAVATRESVVEYFETYGFRIQHLPCLQVGNS-NR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPLERTV-ELN-NYEDPYA-KEFGIKISTSLASVEARILPPPWLKGQWN--MMNKKMINGGTVNNWICINFSRQQELAQGMAFNEKVLKTRD-LLIVILPDNNGSLKRICETELGIVSQCCLSK-QYMANVALKINVKVGGRNTVLVDALSRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEITKYAGLVCAQ-AHRQELIQDLFKELLIAFGHKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEAGYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSM-A-PLP-ALKENV--KRVMFY- Arabidopsis_lyrata_AlAGO10 R-PGFGTGTKC-IVKANHFLADLIIAELVRLYKESDLGKRAYDGRKSLYTA-GEL-PVAIK-FV-A-RANMPQEAVQILD-IVLRELSVKGRSFFSP-DIRRLGEGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIEFVIKKGLRGVKVRKYRVAGLTTQPTRESVIEYFEMYGFTIQHLPCLQVGNQ-KK-AYLPMEACKIVEGQRYTKRQITALLKVTCQRPRDRTV-QHN-AYQDPYA-KEFGMNISEKLASVEARILPAPWLKGQWN--MMNKKMINGMTVSRWACVNFSRSNELGQGMEFNEKALKHVE-LLLAILPDNNGSLKRICETELGLISQCCLSK-QYLANVSLKINVKMGGRNTVLLDAISCR-IPLVSDIPTIIFGADVTHPNGEE-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKDLLISFGQKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFIVVQKRHHTRLFTVVDTKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADGIQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDNGSP---PLP-ALKENV--KRVMFY- Arabidopsis_lyrata_AlAGO2 R-PDRGGVRRV-NLYVNHFRVNFVRDKVFTDN-PNEFPFAAYDGQKNIFSA-AEL-PFTIK-QV-N-ELKLPRDVLQGMD-VVMKEHPSKGKSFFTR-ETEDFGFGVKGYRHTLKPTAGLSLCLYS-VLAFRKMSVIEYLVEKELTGLKVQKLTIVGLSMQDTKDSIVEYFIKYGRDIVHIPCLDLGKN-GR-QFVPMEFCDLVEGQIYPKDSALWLKKLSLVNPQQRMI-KSRNGPGGEII-GNFGLKVDTNMTPVEGRVLKAPTLKNQWN--LMKKGVTRGSIVKHWAVLDFTASDNLIDGMQMEEELLRSVT-LVLCAMSRKDDGLKWIAETKLGLVTQCFLGD-QYWANLALKMNAKVGGSNVELMD----T-FSFFKEDEVMFIGADVNHPARDK-M-S--PSIVAVVGTLNWPAANRYAARVIAQ-PHRKEEIQGF--ELVKAHGKRPNKIVIF-RDGVSDAQFDMVLNVELLDVKLTF-EKN--GYNPKITVIVAQKRHQTRFFTVVDTKVIHPYEYDFYICSHHGGGTSKPTHYYTLWDELGFTSDQVQKLIFEMCFTFTRCTKPVSLVPPVYYADMVAFRRMYHEEKNFR-Q-AIF-KLHAEL--ENVMFF- Arabidopsis_lyrata_AlAGO3 R-PDRGGVQRV-NLSVNHFNVSFVKEKVFTDN-PDKFPFAAYDGQKNIFSA-AEL-SFTIK-QV-NDELKLPRDVLQGMD-VVMKEHPSKGKSFFTR-EP-DFRFGVKGYRHTLKPTAGLSLCLYS-VLAFRNMSVIDYLVEKELTGLKVQKLTIVGLSEYNTKDSIVKYFEKYGKDIRYIPCLSLGKK-GR-QYVPMEFCNLVEGQIYPKESASRLKHLSLVNPQRRMI-KLRDGPGGDII-GNFGLKVATNMTTVEGRVLKAPTLMNQWN--LTIKRVTKGSKIKHWAVLDFTASEELTAGMTLEEELLRSVT-LVLCAMSGKVDGLKWLAETKLGLVTQCFLGD-QYLANLALKINAKVGGTNVELVDN---Y-FSFFKEDEVMFIGADVNHPAHDK-M-S--PSIVAVVGTLNWPEANRYAARVKAQ-THRKEEIQGF--ELVNAHKKRPNKIVIF-RDGVSDGQFDMVLNVELQNVKDTF-KKI--EYNPLITVIVAQKRHQTRFFTVVDTKIIHPFEYDFYLCSHHGAGTSKPTHYYVLYDEIGFKSDQIQKLIFDVCFTFTRCTKPVALVPPVSYADKAASRRLYYEEKNSK-Q-EIF-KVHTEI--ENNMFF- Arabidopsis_lyrata_AlAGO4 R-KGFGTGQKI-PLLTNHFKVDVILDKVHETY-HSDLDGKAYDGEKTLFTY-GAL-PVEIS-YA-A-KIPLSQEAIRVLD-IILRQHAARRQSFFHN-DPSQVGGNIRGFHSSFRTTQGMSLNMVT-TTMIIKGPVVDFLAKRTLKNLRVQEFRITGLSDKPCRETVADYFEIRHIDLQYLPCINVGKP-KR-PYIPLELCALIPLQRYTKAQRSALVEKSRQKPQERAL-KVS-NYAEPLL-RSCGISISSNFTQVEGRVLPAPKLKGRWN--FNNKQFVEPTKIERWVVVNFSARDDLIKGIEIAENMFKDIQ-FILCVLPEKKNCWKKKNLTEFGIVTQCMAND-QYLTNLLLKINAKLGGLNSMLSVERTPA-FTVISKVPTIILGMDVSHGPGQS-D-V--PSIAAVVSSREWPLISKYRASVRTQ-PSKAEMIESLFKELLVDFKRKPEHIIIF-RDGVSESQFNQVLNIELDQIIEAC-KLLDANWNPKFLLLVAQKNHHTKFFTIIDNKICHPKNNDFYLCAHAGMGTTRPTHYHVLYDEIGFSPDELQELVHSLSYVYQRSTTAISVVAPICYAHLAAAQGTFMKSETSS-S-QLP-KLKDNV--ANSMFF- Arabidopsis_lyrata_AlAGO5 R-PGRGTGKKV-LIRANHFLVQIVMKLLVKNYKDSHLGGKAYDGRKSLYTA-GAL-PVAIK-LA-S-RPDLPYDTIQVLD-VVLRDKPSNGRSFFHT-SLGELGDGIRGFFQSLRLTQGLSLNIVS-ARSFYEIVVTEFIVKKVLRTLKVKSAKISGISSCPISQTVIQYFEKYNYRVKYLPAIQTGSD-TR-PYLPMELCQIDEGQRYTKRQVTALLRATCQRPQERLV-VKN-NYNVHGLSKEFGMSVTSQLASIEARVLPPPMLKGQWN--MINKKMVNGARVASWTCVNFSTRKQLTGGMEFNEEALHDIQ-LLIVILPDVTGSIKRICETELGIVSQCCQNK-QYMENVALKINVKTGGRNTVLNDAIRRN-IPLITDRPTIIMGADVTHPPGED-S-S--PSIAAVVASMDWPEITKYRGLVSAQ-AHREEIIQDLYKEHFIAFGQIPQRIIFY-RDGVSEGQFSQVLLHEMTAIRKAC-NSLQENYVPRVTFVIVQKRHHTRLFTVVDTTICHPNEFDFYLNSHAGIGTSRPAHYHVLLDENGFTADQLQMLTNNLCYTFARCTRSVSIVPPAYYAHLAAFRRYYMEDGGSS-R-QLP-AIKDNV--KDVMFY- Arabidopsis_lyrata_AlAGO6 R-RGVGTGNPI-ELCTNHFNVSVLMDQLFKTY-SSDLDGKAYDGEKTLYTV-GPL-PVQIH-FA-A-KIPLAQDALRVLD-IVLRQQAAERQAFFHS-DGHEVGGGVRGFHSSFRPTHGLSLNIVS-TTIILEGPVLEFLAAKMLKHMRVMEFKIIGLSQKPCNQTVYDYFKQTYTEPISLPCLDVGKP-NR-PYLPLEFCNLVSLQRYTKAQRALLVEKSRQKPLERAM-HTY-CFKDPFL-AGCGISIEKQMTQVEGRVLKPPMLKGRWN--FNNKMLLEPKAIKNWAIVNFSFPRELISGIEIDEKMIAKMH-FILCVLPERKTSWKKICLTEEGIHTQCICSD-QYLTNVLLKINSKLGGINSLLGIEYSYN-IPLINKIPTLILGMDVSHGPGRA-D-V--PSVAAVVGSKCWPLISRYRAAARTQ-SPRLEMIDSLFQELFVEFSRKPKQIIIF-RDGVSESQFNQVLNIEVDQIIKAY-QRLGESDVPKFTVIVAQKNHHTKLFTVVDTKIVHPTNYDFYMCAHAGIGTSRPAHYHVLLDEIGFSPDDLQNLIHSLSYVNQRSTTATSIVAPVRYAHLAA--AQFAKSEDGK---ELP-RLHENV--ETNMFF- Arabidopsis_lyrata_AlAGO7 R-PDFGGGSVI-YLLANHFLVKFIKQKLVETD-VNSFSGVAFDGRQNIYSP-VEF-QVNMR-LV-S-KFDGPPEYIHALD-VILRENPMEGRSFYSS-SMGEIGGGARGFFQSLRQTQGLALNMLS-ITAFHEIGVIAYLVEKALKNIRIQRYRVYGLTEEITDNRLMSYFDHYGYEIQYLPCLQISR--AR-PYLPMELCMICEGQKFLGKQAAKIMKMGCQKPNERVM-TGLVGPSGNQT-REFNLEVSREMTLLKGRILQPPKLKRPRN--LKESRAFKGTRIERWALMSIGGSNELTQGVFLSESKLKEIQ-LIICVMEKKHKGLKRIAETRIGVVTQCCLSS-QFVSNLALKINAKIGGSMTELYNSIPSH-IPRLPDEPVIFMGADVTHPPFDD-C-S--PSVAAVVGSINWPEANRYVSRMRSQ-THRQEIIQDL--ELLDDFNKLPNRIIFF-RDGVSETQFKKILQEELQSIKIAC-SKFQ-DYNPSITFAVVQKRHHTRLFTVVDTVITHPKEFDFYLCSHLGVGTSRPTHYHILWDENEFTSDELQRLVYNLCYTFVRCTKPISIVPPAYYAHLAAYRRLYIENGGSM-N-PLP-KLSDNV--KNLMFY- Arabidopsis_lyrata_AlAGO8 R-RGNGSGKKI-HLLTNHFRVNFILEKVQQTY-QTDLGFKAYDGDKNLFTA-GPL-PVAIS-FA-A-KIPMFQDAIRVMD-VILCQNAARRQSFFHN-DAKNIGEGVKGFHSSFRTTQGLSLNIVS-TTMIVKGPVVGFLAKSTLKNLRVQEYKITGLSGLHCKDTVFDYFKIRDIKLHYLPCINVGKP-NR-PYFPIELCELVSLQRYTKAQRSNLVKESRQNPHQRAL-KNS-NYDDPML-QECGVRIGSDFTQVEGRLLPTPKLKGRWN--FNNKIVFESATVTRWAVVNFSARRDLIRGINVDEKMFERLN-FLLCIL-EKKNSWKKKNLVQVGIVNQCIAND-HYLTNVLLKINAKLGGLNSVLDMERSRA-MPLVMKVPTIIIGMDVSHGPGQS-D-V--PSIAAVVSSREWPLISKYRACVRTQ-SRKVEMIDNLFKELLLDF-VKPNHIIIF-RDGVSESQFNQVLNIELDQM--------------------KQKNHHTKFFTIIDSNICHQHNNDFYLCAHAGMGTTRPTHYHVLYDEIGFDTDQLQELVHSLSYVYQRSTTAISLVAPICYAHLAAAQGTAMKSETSS-S-PMP-KLNTKV--ASSMFF- Arabidopsis_lyrata_AlAGO9 RPRGSGSGQKI-PLLTNHFGVKFILDKVQETY-QSDLGSKAYDGEKTLFTV-GAL-PVEIS-YA-A-KIPMLQDALRVLD-IILRQSAARRQSFFHN-DVKPIGGGVRGFHSSFRTTQGLSLNITS-TTMIVQGPVVDFLARRVLKNLRVREYKISGLSEHSCKDTVLNYYE-RNIEVRYFPCINVGKP-KR-PYFPIEFCNLVSLQRYTKSQRAALVEKSRQKPPERGL-KDS-NYADPVL-QDSGVSIITNFTQVEGRILPTPKLKGRWN--FNSRKLVEPTTVTRWAVVNFSARRDLIRGINVEENMFEQIL-FLLCILSERKNSWKKKNLVDLGIVTQCIAND-QYLTNVLLKINAKLGGLNSLLAIERSPA-MPKVTQVPTIIVGMDVSHGPGQS-D-I--PSIAAVVSSRQWPLISKYKACVRTQ-SRKMEMIDNLFKELLLDFKRKPEHIIIF-RDGVSESQFNQVLNIELDQMMQAC-KFLDEHWNPKFTVIVAQKNHHTKFFTIIDSQICHPRNFDFYLCAHAGMGTTRPTHYHVLYDEIGFATDDLQELVHSLSYVYQRSTTAISVVAPVCYAHLAAAQGTVMKSETSS-S-PMP-QLNDKV--ATSMFF- Arabidopsis_thaliana_AtAGO1 R-PGKGQGKRC-IVKANHFFAELVMKQLVDNYRDSHLGSRAYDGRKSLYTA-GPL-PVVIK-LV-A-RADLPQEALQVLD-IVLRELPTSGRSFYSP-DIGSLGDGLRGFYQSIRPTQGLSLNIMS-STAFIENPVIQFVIKKALRGVKVRKYRISGLTAVATRESVVEYFETYGFRIQHLPCLQVGNS-NR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPIDRTV-QLN-DYKDNYA-QEFGIKISTSLASVEARILPPPWLKGQWN--MMNKKMINGGTVNNWICINFSRQQELAQGMAFNEKVLKTRD-LLIVILPDNNGSLKRICETELGIVSQCCLSK-QYMANVALKINVKVGGRNTVLVDALSRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEITKYAGLVCAQ-AHRQELIQDLFKELLIAFGHKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEAGYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSM-A-PLP-ALKENV--KRVMFY- Arabidopsis_thaliana_AtAGO10 R-PGFGTGTKC-IVKANHFLADLIIAELVRLYKESDLGRRAYDGRKSLYTA-GEL-PVAIK-FV-A-RANMPQEAVQILD-IVLRELSVKGRSFFSP-DIKRLGEGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIEFVIKKGLRGVKVRKYRVAGLTTQPTRESVIEYFEMYGFTIQHLPCLQVGNQ-KK-AYLPMEACKIVEGQRYTKRQITALLKVTCQRPRDRTV-QHN-AYQDPYA-KEFGMNISEKLASVEARILPAPWLKGQWN--MMNKKMINGMTVSRWACVNFSRSNELGQGMEFNEKALKHVE-LLLAILPDNNGSLKRICETELGLISQCCLSK-QYLANVSLKINVKMGGRNTVLVDAISCR-IPLVSDIPTIIFGADVTHPNGEE-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKDLLISFGQKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFIVVQKRHHTRLFTVVDTKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADGIQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYLEDNGSP---PLP-ALKENV--KRVMFY- Arabidopsis_thaliana_AtAGO2 R-PDRGGVRRV-NLYVNHYKVNFVRDKVFTDN-PDEFPLAAYDGQKNIFSA-VEL-PFTIK-QV-N-VLKLPRDVLQGMD-VVMKEHPSKGKSFFTR-ETEDFRFGVKGYRHTLKPTAGLSLCLYS-VLAFRKMSVIEYLVEEELIGLKVQKLTIVGLSMQNTKDSIVEYFIKYGRHIVHIPCLDLGKN-GR-QFVPMEFCDLVEGQIYPKDSALWLKKLSLVNPQQRMI-KARNGPGGEII-GNFGLKVDTNMTPVEGRVLKAPSLKNQWN--LMKKGVTRGSIVKHWAVLDFTASDNLIDGMQMEEELLRSVT-LVLCAMSRKDDGLKWIAETKLGLVTQCFLGD-QYRANLALKMNAKVGGSNVELMD----T-FSFFKEDEVMFIGADVNHPARDK-M-S--PSIVAVVGTLNWPEANRYAARVIAQ-PHRKEEIQGF--ELVKAHGKRPNKIVIF-RDGVSDAQFDMVLNVELLDVKLTF-EKN--GYNPKITVIVAQKRHQTRFFTVVDTKVIHPYEYDFYLCSHHGGGTSKPTHYYTLWDELGFTSDQVQKLIFEMCFTFTRCTKPVSLVPPVYYADMVAFRRMYHEEKNFK-Q-AIF-KLHAEL--ENVMFF- Arabidopsis_thaliana_AtAGO3 R-PDKGGVKGVINLSVNHFRVSFVKEKLFKDN--NDFPNAAYDGQKNIFSA-VEL-PFIIK-QV-K-ELKLPRDVLQGMD-VVMKEHPSKGKRFFST-RL-DFGYGVKGFHHTLKPTVGLSLCLSS-LLAFRKISVIEYLVVQELIGLKVQKFIIMGLSKDDTKDSIVEYFEKYGRDIDHIPCLNLGKK-GR-EFVPMEFCNLVEGQIFPKESAAWLKELSLVTPQQRMI-KSSDGPGGDII-GNFGLRVDPNMTTVEGRVLEAPTLKNQWN--LTTKGVTKGSIIKHWAVLDFTASNKLIEGMQMEEELLRSVT-LVLCAMTGKHDGLKWIAETKLGLVTQCFLSD-QYLANLALKINAKVGGTNVELVDN---I-FSFFKEDKVMFIGADVNHPAHDN-M-S--PSIVAVVGTLNWPEANRYAARVKAQ-SHRKEEIQGF--ELIEAHEKRPNKIVIF-RDGVSDGQFDMVLNVELQNVKDVF-AKV--GYNPQITVIVAQKRHQTRFFTVVDTTIIHPFEYDFYLCSQHGAGTSKPTHYYVLSDEIGFNSNQIQKLIFDLCFTFTRCTKPVALVPPVSYADKAASRRVYYEKKNSK-Q-EIF-KVHAGI--ENFMFF- Arabidopsis_thaliana_AtAGO4 R-KGFGTGQKI-PLLTNHFKVDVILDKVHQTY-HSDLDGKAYDGEKTLFTY-GAL-PVEIS-YA-A-KIPLSQEAIRVLD-IILRQHAARRQSFFHN-DPTPVGGNIRGFHSSFRTTQGMSLNMVT-TTMIIKGPVVDFLAKRTLKNLRVQEFKITGLSDKPCRETVADYFDTRHIDLQYLPCINVGKP-KR-PYIPLELCALVPLQRYTKAQRSALVEKSRQKPQERAL-KVS-NYAEPLL-RSCGISISSNFTQVEGRVLPAPKLKGRWN--FNNKEFVEPTKIQRWVVVNFSARDDLIKGIEIAENMFKDIQ-FILCVLPDKKNSWKKKNLTEFGIVTQCMAND-QYLTNLLLKINAKLGGLNSMLSVERTPA-FTVISKVPTIILGMDVSHGPGQS-D-V--PSIAAVVSSREWPLISKYRASVRTQ-PSKAEMIESLVKELLVDFKRKPEHIIIF-RDGVSESQFNQVLNIELDQIIEAC-KLLDANWNPKFLLLVAQKNHHTKFFTIIDNKICHPKNNDFYLCAHAGMGTTRPTHYHVLYDEIGFSADELQELVHSLSYVYQRSTSAISVVAPICYAHLAAAQGTFMKSETSS-S-QLP-RLKDNV--ANSMFF- Arabidopsis_thaliana_AtAGO5 R-PGRGTGKKV-MVRANHFLVQVVMKLLVKNYKDSHLGGKAYDGRKSLYTA-GPL-PVAVK-NV-T-STDLPYDTIQVLD-VVLRDKPSNGRSFFHT-SLGELGDGIRGYFQSLRLTQGLSLNIVS-ARSFYEIVVTDFIVKKVLRTLKVKSAKISGISSLPIRETVVQYFEKYNYRVKYLPAIQTGSD-TR-PYLPMELCQIDEGQRYTKRQVTALLKATCQRPPDRLV-VKN-NYDD--LSKEFGMSVTTQLASIEARVLPPPMLKGQWN--MIDKKMVNGAKVTSWTCVSFSTRKQLIGGMEFKEEALLDIQ-LLIVILPDVTGSIKRICETELGIVSQCCQNK-QYMENVALKINVKTGGRNTVLNDAIRRN-IPLITDRPTIIMGADVTHPPGED-S-S--PSIAAVVASMDWPEINKYRGLVSAQ-AHREEIIQDLYKEHFIAFGQIPQRIIFY-RDGVSEGQFSQVLLHEMTAIRKAC-NSLQENYVPRVTFVIVQKRHHTRLFTVVDTKICHPNEFDFYLNSHAGIGTSRPAHYHVLLDENGFTADQLQMLTNNLCYTYARCTKSVSIVPPAYYAHLAAFRRYYMEDGGSS-R-QLP-AIKDNV--KEVMFY- Arabidopsis_thaliana_AtAGO6 R-RGVGTGNPI-ELCTNHFNVSVLMDQLFKTY-SSDLDGKAYDGEKTLYTV-GPL-PVQIH-YA-A-EIPLAQDALRVLD-IVLRQQAAERQAFFHS-DGHKVGGGVRGLHSSFRPTHGLSLNIVS-TTMILEGPVIEFLAAKMLKHMRVMEFKIIGLSSKPCNQTVYDYFKQTYTEPISFPCLDVGKP-DR-PYLPLEFCNLVSLQRYTKPQRVLLVESSRQKPLERAM-HTY-CYKDPFL-AGCGISIEKEMTQVEGRVLKPPMLKGRWN--FNNKMLLEPRAIKSWAIVNFSFPRELISGIEIDEKMIATMH-FILCILPERKTSWKKICLTEEGIHTQCICSD-QYLTNVLLKINSKLGGINSLLGIEYSYN-IPLINKIPTLILGMDVSHGPGRA-D-V--PSVAAVVGSKCWPLISRYRAAVRTQ-SPRLEMIDSLFQELFVEFARKPKQIIIF-RDGVSESQFEQVLKIEVDQIIKAY-QRLGESDVPKFTVIVAQKNHHTKLFTVVDTKIVHPTNYDFYMCAHAGKGTSRPAHYHVLLDEIGFSPDDLQNLIHSLSYVNQRSTTATSIVAPVRYAHLAAAQAQFTKSEDGK---ELP-RLHENV--EGNMFF- Arabidopsis_thaliana_AtAGO7 R-PDFGGGSVI-YLLANHFLVKFIKQKLVETD-RNSFSGVAFDGRQNIYSP-VEF-QVNMK-LV-S-KFDGPPEYIHALD-VILRENPMEGRSFYSS-SMGEIGGGARGFFQSLRHTQGLALNMLS-ITAFHEIGVIAYLVEKALKNIRVQRYRVYGLTEEITENRLMSYFDHYGYEIQFLPCLQISR--AR-PYLPMELCMICEGQKFLGKQAAKIMKMGCQKPNERVM-TGSVGPSGNQT-REFNLEVSREMTLLKGRILQPPKLKRPRN--LKESKVFKGTRIERWALMSIGGSNELTQGVFLSESKLKEIQ-LIICVMEKKHKGLKRISETRIGVVTQCCLSS-QFVSNLALKINAKIGGSMTELYNSIPSH-IPRLPDEPVIFMGADVTHPPFDD-C-S--PSVAAVVGSINWPEANRYVSRMRSQ-THRQEIIQDL--ELLDDFKKLPNRIIFF-RDGVSETQFKKVLQEELQSIKTAC-SKFQ-DYNPSITFAVVQKRHHTRLFTVVDTVITHPKEFDFYLCSHLGVGTSRPTHYHILWDENEFTSDELQRLVYNLCYTFVRCTKPISIVPPAYYAHLAAYRRLYIENGGSM-N-PLP-KLSDNV--KNLMFY- Arabidopsis_thaliana_AtAGO8 R-RGNGSGQKI-LLLTNHFRVNFILEKVQQTC-QADLGCKAYDGDKNLYTV-GPL-PVAIL-FAPP-EIPMLLDAIRVMD-CILSQNAARRQSFFHN-DAKNIGEGVKGFHSSFRTTQGLSLNIVS-TAMIVKGPVVDFLAKNTLKNLRVQEYKITGLSGLHCKDTVSDYFRIREIELRYLPCINVGKP-NR-PYFPIELCELVSLQRYTKAQRSNLIKESRQNPQQRAL-KTS-NYDDPML-QECGVRIGSDFTQVEGRVLPTPKLKGSWN--FKNK----PATVTRWAVVNFSARDDLTRGINVDDKMFQHLK-FLLCIL-EKKNS--EKSCSMWN--CECIVND-QYLTNLLLKINAKLGGLNSVLDMELSGT-MPLVMRVPTIIIGMDVSHGPGQS-DHI--PSIAAVVSSREWPLISKYRACVRTQ-SPKVEMIDSLFKELLLDF-KKPNHIIIF-RDGVSESQFNQVLNIELDQMM--------------------QINHHTKFFTIIDSNICHQHNNDFYLCAHAGKGTTRPTHYHVLYDEIGFDTDQLQELVHSLSYVYQRSTTAISLVAPICYAHLAAAQATAMKSETSS-S-PMP-KLNTNV--ASSMFF- Arabidopsis_thaliana_AtAGO9 RPRGSGSGQKI-PLLTNHFGVKFILDKVQETY-QSDLGAKAYDGEKTLFTV-GAL-PVEIS-YA-A-KIPMLQDALRVLD-IILRQSAARRQSFFHN-DVKPIGGGVRGFHSSFRTTQGLSLNITS-TTMIVQGPVVDFLARRVLKNLRVREYKISGLSEHSCKDTVLNYYE-RNIEVRYFPCINVGKP-KR-PYFPIEFCNLVSLQRYTKSQRAALVEKSRQKPPERGL-KDS-NYADPVL-QDSGVSIITNFTQVEGRILPTPMLKGKWN--FMRKTLAEPTTVTRWAVVNFSARRDLIKGINVEENMFEQIL-FLLCILAERKNSWKKKNLVDLGIVTQCIAND-QYLTNVLLKINAKLGGLNSLLAMERSPA-MPKVTQVPTIIVGMDVSHGPGQS-D-I--PSIAAVVSSRQWPLISKYKACVRTQ-SRKMEMIDNLFKELLLDFNRKPEHIIIF-RDGVSESQFNQVLNIELDQMMQAC-KFLDDTWHPKFTVIVAQKNHHTKFFTIIDSQICHPRNFDFYLCAHAGMGTTRPTHYHVLYDEIGFATDDLQELVHSLSYVYQRSTTAISVVAPVCYAHLAAAQGTVMKSETSS-S-PMP-QLHNNV--STSMFF- Arabidopsis_thaliana_AtAGOlike R-PGKGQGKRC-IVKANHFFAELVMKQLVDNYRDSHLGSRAYDGRKSLYTA-GPL-PVVIK-LV-A-RADLPQEALQVLD-IVLRELPTSGRSFYSP-DIGSLGDGLRGFYQSIRPTQGLSLNIMS-STAFIENPVIQFVIKKALRGVKVRKYRISGLTAVATRESVVEYFETYGFRIQHLPCLQVGNS-NR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPIDRTV-QLN-DYKDNYA-QEFGIKISTSLASVEARILPPPWLKGQWN--MMNKKMINGGTVNNWICINFSRQQELAQGMAFNEKVLKTRD-LLIVILPDNNGSLKRICETELGIVSQCCLSK-QYMANVALKINVKVGGRNTVLVDALSRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEITKYAGLVCAQ-AHRQELIQDLFKELLIAFGHKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEAGYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSM-A-PLP-ALKENV--KRVMFY- Brachypodium_distachyon_BdAGO12like R-PGFGTGKRC-RVRANHFLVQVIINELVRLHKQ-YLDGRVYDGRKSIYTA-GAL-PVTIK-HA-S-NLDLPQDTIQALD-IALRECPTTSRSFFS--QYGDIGNGARGYYQSLRPTQGLSLNIIL-ATAFYKQPVMAFALKKALRGVRVIRYKISGIPAAPLKESVVQYFQQYNYSLKYWPCLQAGSD-SR-PYLPMEVCSIVEGQRYSRKQVTGILRMACERPAQRIV-NRN-NYNDHYS-KEFGMNVMNQLTLVDARVLPAPRLKGQWN--MINKRMVNGGSMNYWACITFSSRHDLAQGMVIYESAIRNIE-LLIIILPDISGSIKRLCETELGLMTQCCLGK-QYLENLSLKINVKTGGSNTVLEDALYKR-IPLLTDVPTIVFGADVTHPPGED-A-S--PSIAAVVASMDWPEVTKYKCLVSSQ-GHREEIIADLFSELLVSFKCKPSRIIFY-RDGVSEGQFSQVLLYEMDAIRKAC-ATLQEGYLPPVTFVVVQKRHHTRLFTVVDTKIFHPTEFDFYLCSHAGIGTSRPTHYHVLLDENGFSADALQTLTYNLCYTYARCTRSVSIAG--TWEKLTGWGRVFDQDKFLE-K-KMA-AMGRAI--------- Brachypodium_distachyon_BdAGO16like R-PGFGRGKPI-RLMSNHFAVKLVIDKMLQTY-SSELAGKAYDGEKCLFTV-GPL-PVGIS-YA-A-KIPLAQDALRVLD-IVLRQQQAKRQSFFSD-DNRDLTGGVRGLHSSFRTTMGLSLNMVS-TTMIVTGPVVHFLAKKMLKNLRVMEFKIIGLSDQPCSRTVEEYFKSKEVFLA-LPCLDVGKP-KR-PYLPIELANMVSLQRYTKAQRATLVEKSRQKPQDRAV-KSN-KYDDPIF-STCGIKIEKQLTHVDGRVLSAPMLVGRWN--YNNKKLFEPVRIERWAIVNFSARRDLINGIIIEERMFEKVE-FLLCVLPERKNCWKKKNLHEMGIVTQCIVND-QYFTNVLLKINAKLGGMNSKLALEHSHM-IPIVNKKPTLILGMDVSHGPGRS-D-I--PSIAAVVGSRCWPLISRYRASVRTQ-SPKVEMIDSLFKELLLDFQRKPTQIIIF-RDGVSESQFSQVLNLEVNQIIKAY-QNMGQGDPPKVTVIIAQKNHHTKLFTVVDSGIVHPKQYDFYMCAHAGPGTSRPTHYHVLLDEIGFSPDDLQKLVLSLSYVYQRSTTAISVVAPICYAHLAAAQSQFMKADTSS-G-ELP-RLHADV--CSSMFF- Brachypodium_distachyon_BdAGO18like R-PGFGSGKAC-IVKANHFFVGLVMSRLVSEHQHTSLGGRAYDGRKTLYTA-GQL-PVAIK-HV-T-LVSLPSQALQVLD-IVLRDMILNGRSFFSA-SIDHLGLGIKGFYQSIRPTQGLSLNIMS-STAFVKQSVIKFVIKKALKGVRVRKYCISGLAGTA-RDTVMDYFETYKLQLRYLPCLDVGTT-QK-PYLPMEVCNIVPGQRYQKKQVSNMMQITCQQPLQRTV-RCN-NYNTKRA-NEFGIEVDYEPTSVQARVLPAPMLKGAWN--MRGKKVVDGARVVNWLCINFCVDNGLSNGLFVNEANLHNVD-LLLALLPDKNDSIKRICETDIGVMSQCCLSP-QFFANVAIKINAKCGGRNSVFANR-QAS-LPVVSAKPTIIFGADVTHPALDD-A-T--PSIASVVASKDWPEVTKYHGVVRAQ-GHREELIQGL--ELLRSFNRRPEQLIFY-RDGVSEGQFKQVLEKEIPEIEKAW-KAIY-NEEPQITFIVVQKRHHTRLFTVVDRQVCHPTEFDFFLCSHAGIGTSRPTHYHVLRDDNKFTADALQSLTNNLCYTYASCTRSVSIAPPVYYAHKLAFRRFYQTVESVA-S-ALP-EIKDEV--KRLMFY- Brachypodium_distachyon_BdAGO1Alike R-PGKGKGNRC-IVKANHFSAELVMGQLVTLFRQSHLGGSAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTAARSFYSP-NLGQLGDGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVIKKALRGVKVRKYRISGLTSQATRETVVRYFETYGFNIQHLPCLQVGNP-QR-PYLPMEVCKIIEGQRYSKRQITALLKVTCQRPQQRTV-NHN-AYEDPYA-QEFGIRIDKKLASVEARILPPPRLKGQWN--MKNKKMVNGGRVKDWTCINFSRHHELAVGMEFSERALKARD-LLIVILPDNNGSLKRICETDLGLVSQCCLNQ-QYLANVALKINVKVGGRNTVLVNALSRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEITKYAGLVSAQ-TRRQELIQDLFKELLISFGQKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFTADGLQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYLEDSGSA-M-PLP-DLKDNV--KRVMFY- Brachypodium_distachyon_BdAGO1Blike R-PGKGTGDRC-VVKANHFFAELVMAELVKLYRQSHLDGRAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTAGRSFYSP-NLGKLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIEFVIKKALRGVKVRKYRISGLTSQATRETVVQYFETYGFNIQHLPCLQVGNQ-QR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPQERTV-HHN-AYEDPYA-QEFGIKIDERLASVEARVLPPPRLKGQWN--MMNKKMVNGGRVSNWACINFSRNHELAIGMDFAERALKARD-LLIVILPDNNGSLKRICETDLGLVSQCCLSK-QYLANVALKINVKVGGRNTVLVDALTRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEVTKYAGLVSAQ-AHRQELIQDLFKELLISFGQKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFTADELQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSM-A-PLP-ALKENV--KRVMFY- Brachypodium_distachyon_BdAGO1Clike R-PGKGSGTKI-LVKANHFFTQLVINELVNLYKASYLGGRVYDGRKSLYTA-GPL-PVVIK-FS-A-QANLPQEAIQVLD-IVLRQLPSTGRSFFSP-EPNSLGDGLSGFYQSIRPTQGLSLNIMS-ATAFIELPVVEFVTKKALRGVNVRKYRISGLTAQATRESVVQYFDRYRFYIQHLPCLLVGNQ-QR-QYLPMEVCKIVKGQRYSKRQIRNLLDQTCRHPRDRMV-KQN-AYDDPYA-KEFGIKISDRLASVEARILPAPRLKGQWN--MMNKKLVNGGKVRSWMCVNFAYKHDLALGMDFAERALKARD-LLIGILPDNNGSLKRVCETDLGIVSQCCLNK-QILANLALKINVKAGGRNTVLVDALSRR-IPLVTDKPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEVTKYVGIVSAQ-AHRQELIEDLYKELLISFGQKPQRIIFY-RDGVSEGQFYQVLLFELDAIRRAC-ASLEADYQPTVTFVVVQKRHHTRLFTVVDSKICHPNEFDFYLCSHAGIGTSRPAHYHVLRDENNFTADGLQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSV-A-PLP-ALKDNV--KKVMFY- Brachypodium_distachyon_BdAGO1Dlike R-PGRGSGTRC-LVKANHFLAELVMEELVKLHKVSYLGGRAYDGRKSMYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTAGRSFFSP-DLGSLGEGIRGFYQSIRPTQGLSLNIMS-ATSFFELPVIDFVIKKALRGVKVRKYRISGLTSQATRESVVQYFETYGFAIQHLPCLQVGNQ-QR-PYLPMEVCKIVEGQRYSKRQIRVLLEETCQRPHDRMV-NHN-SYDDPYA-KEFGIKISERLSSVEARILPAPRLKGQWN--MMNKKMVNGGRVRSWLCVNFARNRELARGMDFAERALKARE-LLIGILPDNNGSLKRVCEIDLGLVSQCCLNK-QILANLALKINVKVGGRNTVLADALSRR-IPLVTDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEVTKYAGLVSAQ-SHRQELIEDLYKELLISFGEKPQRIIFY-RDGVSEGQFYQVLLHELDAIRKAC-ASLEANYQPQVTFVVVQKRHHTRLFTVVDSKICHPTEFDFFLCSHAGIGTSRPAHYHVLWDENNFTADGLQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGST-A-PLP-ALKDSV--KRVMFY- Brachypodium_distachyon_BdAGO2like D-PKISPGVEV-KLLVNHFTVKFAKAELVKVL-QRPPHSLAYNGMGRLFTF-AEL-PAFAK-LE-N-KVSLPEYLSQGLD-CIVREASSLGQTFYSP-EEVDQPSAVRGTKQTLKHTNGPILCVYS-FMDFCKGGSVRSLLERHLKGLYVRKYKVHGLTKQLAHQKLLEYYQQYGKVIEYLPCLSLSKNSNR-PSVPIELCSLHEWQRYPKENSNQQPNNRPPKLSERMV-KDVDGPRGLGG-EQFKISLGEQMTEVMGRILPPPMLKCQWN--ITRKKVADGINLQYWGILDFSARRDIFFGIRMAYKVLSAAQ-LLFCPMSEQHPGLKQICETKLGIQTQCLLRD-QYMSNLALKINSKLGGSNVQLLSD---G-LPKMAGSHFMFIGADVNHPPNDN-L-S--HSIAAVVASMDCPGASKYVPRIRAQ-KNRCEEIVEL--ELIQVYGVKPQKIIYF-RDGVSDNQFEMVLKQELKQLENML-KALKEGYSPTITAIVAKKRHHTRLFTVVDTDVVNTADQDFFLCSHDGLGTSRPTHYHRLKDDHGFEPVDLQKLVYNMCFLFARCTKPVSLTTPVKYADLAAYRRDYYDESQHS-E-GFPILLHVDL--EDRMVF- Brachypodium_distachyon_BdAGO4Alike R-PGFGKGKPI-QLVTNHFKVSLVIDKLQQTY-ASELAHKAYDGEKSLFTI-GAL-PVELN-FA-S-RIPMTQEAIRVID-IILRQHAAKRQSFFHN-NPSDLGGGVRGFHSSFRATKGLSLNIVS-TTMIVKGAVVDFLAKRALKNLRITEFKIVGLSERNCYESVYDYFKNRGIELRYFPCINVGKP-KR-PYFPIELCSLVPLQRYTKSQRSSLVEKSRQKPQERVL-KRS-SYTDPML-KACGISIAQGFTQVPGRVLQPPKLKGRWN--FNNKRLVRASCVERWAVVNFSARRDLIKGIKVDEAMFETVK-FLLCILAERKNSWKRKCLAEFGIVTQCVAND-QYLTNVLLKINAKLGGMNSLLQIELSPA-IPLVSKVPTMILGMDVSHGPGQA-D-T--PSIAAVVSSREWPLVSKYRASVRSQ-SPKSEMIDSLFK-----------------RDGVSESQFTQVLNKELDQINEAC-KFLDESWSPKFTLIVAQKNHHTKFFTVVDNVVCHPKNYDFYMCAHAGMGTTRPTHYHILHDDIHFTADDLQDLVHSLSYVYQRSTTAISVVSPICYAHLAAAQSQFVKSETSS-S-ELP-RLHEKV--RSSMFF- Brachypodium_distachyon_BdAGO4Blike R-PGLGRGQPI-QLLSNHFKVSVVIDKLQHTY-LSELANKAYDGEKSLFTI-GAL-PVELR-FA-A-KIPMSLEAIRVLD-IILRQHAAKRQSFFHN-NPRDLGGGVRGFHSSFRGTQGLSLNIVS-TTMIVQGPVIDFLAKRALKNLRITEFKIVGLSDRNCNETVYEYFKIRGIELQYLPCINVGRP-KR-PYFPAELCMLLPLERYTKAQRSSLVEKSRQKPQERAL-KRS-NYSDPML-RACGISIARNFTQIEGRVLQAPRLRGRWS--LKHKKLYQTCSVERWAVVNFSARRDLKRGLKIQDAMLAQLN-FLLCLLPDRKNCWKKKCLADLGIVTQCLAND-QYIDNVLLKINAKLGGLNSLLRIEVERT-IPLVSKVPTIILGIDVSHGPGQS-D-R--PSIAAVVSSREWPYISKYRATVNTQ-SPKLEMVSSLFKVSLIDFKRKPDHVIIF-RDGVSESQFTQVINIELEKIIEAC-KFLDEKWSPKFTVIVAQKNHHTKFFTVVDKQVCHPKNFDFYMCAHAGMGTSRPTHYHVLHDEIGFTADELEEFVHSLSYVYQRSTTAVSVVAPICYAHLAAAQGTFLKSDASS-S-PLP-GLHERV--RNTMFF- Brachypodium_distachyon_BdAGO7like R-PDSGGGAVI-PLSANHFLVRFIKNKLVEEN-SSVLSGAAFDGRRDLYSP-FEF-QVNIR-LV-S-KLSGPQDYLHALD-VILREGAMEGRSLYPR-SMGDIGGGARGFFQSLRPTKGLALNVLS-LTAFHETGMIAYLVEKALRNIRVQRYHVHSLTEETTENMVMDYFEQYNHDIQFLPCLQIGR--SK-PYVPMELCVVCEGQKFLGKQTSKILKMGCQRPSERAV-EEAFGARNSYA-DQFNLQVSKDMTQLSGRVLLPPKLKRQWS--LLDSHVTEGSKIKSWALISFGGTNQLSSGIYLNESKLKKIQ-LLICVMERRHRGLKRIAETSIGVVTQCCLTV-QFVANLALKMNAKLGGCNVSLYNSLPCQ-IPRIDDEPVMFMGADVTHPPLDD-S-S--PSVVAVVASMNWPSANKYISRMRSQ-THRKEIIEHL--ELLEEFGKLPARIIFF-RDGVSETQFDKVLKEEMHAVRMTC-SRYP-GYKPLITFIVVQKRHHTRLFTVVDTVITHPREFDFYLCSHWGTGTSRPTHYHILLDENKFGSDELQQLIHNLCYTFVRCTRPVSLVPPAYYAHLAAYRKLYLEVPTSR---PLP-KLSDSV--KRLMFY- Brachypodium_distachyon_BdMEL1like R-PGAGTGRKV-MIRANHFLVDVVLSELIKLHGRKSLGGKAYDGRKSLYTA-GSL-PITIR-IA-G-RTDLPQETIQVLD-VVLRESPSWSRSFFST-TFGDIGEGLRGYYQSLRPTQGLSLNIIS-ATSFFKVTVIQFVIKKALRGVRVRRYKITGITPIPMSQTVVQYFERYNYRLQYWPCLQSGSD-SR-PYLPMEACKIVEGQRYSKKQVTNILRATCQRPQQRMV-LHN-KYEDKFA-QEFGIKVCSDLVSVPARVLPPPMLRGQWN--MINKKMINGGTIDKWACITFS-RCDLVQGMSFCENALRDVQ-LLIVILPEVSGSIKKVCETDLGIVSQCCLNK-QYLENVALKINVKAGGRNTVLDRAFVRNGIPFVSEVPTIIFGADVTHPPGED-S-A--SSIAAVVASMDWPEITKYRGLVSAQ-PHRQEIIEDLFSELLIAFGRRPERIIFY-RDGVSEGQFSHVLLHEMDAIRKAC-ASLEEGYLPPVTFVVVQKRHHTRLFTVVDLMICHPTEFDFYLCSHAGIGTSRPTHYHVLYDENHFTADALQSLTNNLCYTYARCTRAVSVVPPAYYAHLAAFRRYYVEDGGST-P-QLP-NIKENV--KDVMFY- Brachypodium_distachyon_BdMELlike R-PGFGRGQKI-TVRANHFLVRVLMSELLNIHRASSLGGLAYDGSKSLYTA-GEL-PVTIR-FA-A-RANLPQDTIQALD-VALRETPSQSRSFFSS-NFGDIGDGLKGYYQSLRPTQGLSLNITS-STSFYKISVIKYVIKKALRGVRVSSYKITGITSVPLIQTVAQYFERYKYRLEFWPCLQSGND-SR-PYLPMEVCTIIEGQRFTRKQVTGILRATCQRPQLRMV-ESN-NYADRMA-REFGIDVANQMVNVHARVLPPPTLKGQWN--MINKKMVNGANVQRWTCLNFS-RDDLVRGMVVNEGALKDVQ-LLIVILPDVTGHVKKVCETDLGIVTQCLKKK-QYFENVALKINVKAGGRNTALQQALSRQ-TPLVSDRPTIIFGADVTHPAGED-S-S--ASIAAVVASMDWPEITKYKAVVSAQ-PPRQEIIQELFWELLISFNFKPQRIIFY-RDGVSEGQFAQVLLHEMDAIRKAC-ASLQEDYMPPVTFVVVQKRHHTRLFTVVDTNVCHPTEFDFYLCSHAGIGTSRPTHYHVLFDENHFSADELQLLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRRYYDEDGGSV-V-QLP-QIKDKV--KDVMFY- Brachypodium_distachyon_BdPNH1like R-PGFGTGARC-VVKANHFLAEIIIAELVRLYRASDLGMRAYDGRKSLYTA-GTL-PVVIK-FA-A-RADLPQEAVQVLD-IVLRELANQGRSFYSP-DIRRLGDGLCGFYQSIRPTQGLSLNIMS-STAFIELPVIEFVIKKALRGVKVRKYRISGVTAQPTHESVVEYFEMYGFTIQHLPCLMVGNQ-KK-AYLPMEACKIVEGQRYTKRQITSLLKVTCQRPREKTV-HQN-GYQDPYA-KEFGINISEKLTSVEARVLPAPWLKGQWN--MVNKKVINGGKVSHWACINFSRNQELAQGMEFNAKALKHVE-LLLAILPDNNGAIKRICETDLGLISQCCLSK-QYLANVSLKINVKMGGRNTVLVDALSWR-IPLVSDIPTIIFGADVTHPTGED-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKELLISFGQKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFSADEMQTLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRRFYMEENHTS---PLP-AVKEKV--KRVMFY- Brassica_rapa_BrAGO1 R-PGKGQGKRC-IVKANHFFAELVMKQLVDLYRETHLGRRAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPTSGRSFYSP-DIGSLGDGLRGFYQSIRPTQGLSLNIMS-STAFIELPVTEFVIKKALRGVKVRKYRISGLTAVATRESVVEYFETYGFRIQHLPCLQVGNS-NR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPQERTV-GLN-DYHDPYA-KEFGIKISASLASVEARILPPPWLKGQWN--MMNKKMINGGTVSNWICVNFSRQQELAQGMAFNEKVLKTRD-LLIVILPDNNGSLKRICETELGIVSQCCLSK-QYMANVALKINVKVGGRNTVLVDALSRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEITKYAGLVCAQ-AHRQELIQDLFKELLIAFGHKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEAGYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFSADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSM-A-PLP-PLKDNV--KRVMFY- Brassica_rapa_BrAGO10 R-PGFGQGTKC-IVKANHFLADLIIAELVRLYKESELGSRAYDGRKSLYTA-GEL-PVAIK-FV-A-RANMPQEALQILD-IVLRELSVKGRSFFSP-DIRRLGEGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIEFVIKKGLRGVKVRKYRVAGLTTQPTRESVIEYFEMYGFTIQHLPCLQVGNQ-KK-AYLPMEACKIVEGQRYTKRQITALLKVTCQRPRDRTV-QHN-AYQDPYA-KEFGMNISEKLASVEARILPAPWLKGQWN--MMNKKMINGMTVSRWACVNFSRSNELGQGMEFNEKALKHVE-LLLAILPDNNGSLKRICETELGLISQCCLSK-QYLANVSLKINVKMGGRNTVLLDAISCR-IPLVSDIPTIIFGADVTHPNGEE-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKDLLISFGQKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFIVVQKRHHTRLFTVVDTKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRRFYMEDNGSP---PLP-ALKENV--KRVMFY- Brassica_rapa_BrAGO2a R-PDKGGVRRV-NLLVNHFQVNIVRDKLFTDN-PHEFPFAAYDGQKNIFSA-AEL-PFTIN-RV-N-ELKLPRDVLQGMD-VVMKEHPSKGKSFFTR-ETEELGYGIKGYRHTLKPTQGLSLCLYS-VLAFRKMSVIEYLVEKELTGLKVQKLTIVGLSREDTKDSIVEYFIKYGRDIVHIPCLDLGKN-GR-QLVPMEFCALVEGQIYPKDSALWLKKLSLVNPRQRMI-KSKEGPGGEIT-GNFGMKVDTNMTRVEGRVLKAPALKNQWN--LMRKGVTRGSVVKHWAVLDFTASNNLINGMQLEEELLRSVT-LILCAMTGRVDGLKWIAETKLGLVTQCFLGD-QYRANLALKINAKVGGSNVELMD----T-FSFFKDDQVMFIGADVNHPSRDK-M-S--PSIVAVVGTLNWPEANRYAARVIAQ-PHRKEEIQGF--ELVKAHGKRPNKIVIF-RDGVSDGQFDMVLNVELLDVKLTF-EKN--GYNPKITVIVAQKRHQTRFFTVVDTKVIHPFEYDFYLCSHHGGGTSKPTHYYTLWDELGFTSDQVQKLIFEMCFTFTRCTKPVSLVPPVYYADMVAYRRMYHEEKNIRQQ-AIF-KLHKEL--ENVMFF- Brassica_rapa_BrAGO2b R-PDKGGVRRV-NLLVNHFRVHIVRDKLFTDN-PGEFPLAAYDGQKNIFSA-AQL-PFTIK-QV-N-ELMLPRDVLQGMD-VVMKEHPSKGKSFFTR-ETKDLGFGLKGYRHALKPTAGLSLCLYS-VLAFRKMSVIEYLVEMELTGLKVQKLTIVGLSRKDTKDSIVEYFIKYGKDIVHIPCLDLGKN-GR-QLVPMELCILVEGQVYPKESALWLKTLSLVNPQQRMI-ESNDGPGGEII-GNFGMKVDTEMTPVVGRVLKAPALKNQWN--LMKKGVTRGSVVKHWAVLDFTASGLLINGMQLREDLLRQVT-LVLCAMSGRVDGLKWIAETKLGLVTQCFLGD-QYLANLALKINAKVGGSNVELMDS---G-YSFFREDEVMFIGADVNHPARDT-T-S--PSIVAVVGTLNWPEANRYAARVIAQ-PRRKEEIQGF--ELVKAHRKRPNKIVIF-RDGVSDGQFDMVLNRELLDVKLTF-ERD--NYFPKITVIVAQKRHQTRFFTVVDTKVIHPFEYDFYLCSHHGGGTSKPTHYYALWDELDFTSDQMQKLIFDMCFTFTRCTKPVSLVPPVYYADMVAFRRIYHEEKNIR-Q-AIF-KLHKEL--ENVMFF- Brassica_rapa_BrAGO4 R-PGFGSGQKI-QLLTNHFGVKVVLDKVHETY-HSDLDGKAYDGEKTLFTF-GAL-PVEIS-YA-A-KIPLSQEAIRVLD-IILRQHAARRQSFFHN-DPSPVGGNIRGFHSSFRTTQGMSLNMVT-TTMIIKGPLVDFVAKRTLKNLRIQEYRITGMSDKPCRETVYDYFRERNLELQYLPCVNVGRP-KR-PYIPLEHCTLIPLQRYTKAQRSALVEKSRQKPQERAL-KVS-NYAEPLL-RSCGISISSNFTQVEGRVLPAPKLKGRWN--FNNKQFVEPTKIDKWAVANFSARDDLIRGIEIAEKMFEEIQ-FLLCLLPERKNCWKKKNLTEYGIVTQCMAND-QYLTNCLLKINAKLGGLNSMLSVERTPA-FTVISKVPTIILGMDVSHGPGQS-D-V--PSIAAVVSSRQWPLVSKYRASVRTQ-PSKAEMIESLVKELLVDFKRKPEHIIIF-RDGVSESQFNQVLNIELDQIIEAC-KLLDENWNPKFLLLVAQKNHHTKFFTIIDNKICHPKNNDFYLCAHAGMGTTRPTHYHVLYDEIHFSPDELQELVHSLSYVYQRSTTAISVVAPICYAHLAAAQGTFMKSETSS-S-QLP-KLKDNV--ANSMFF- Brassica_rapa_BrAGO5 R-PGFGQGKKV-TIRANHFLVQVVMTTLVKTYGESHMAKKAYDGRKSLYTA-GPL-PVAIK-LA-S-RPDLPYETIQVLD-VVLRDLPSQGRSFFDP-SLGELGDGVSGYFQSLRLTQGLSLNIVS-ARSFYEILVTEFIVKKALKSLKVRSVKVSGISSCPISETVVQYFEKYNYRVKYLPAIQSGSD-SR-PYFPMELCRIAEGQRYTKKQVTALLRATCQRPDIRMV-KNN-KYEIDLVRKEFGMSVTDQLATVEARVLPPPLLKGQWN--MIDKKMINGARVASWTSVCFSTRKQLIDGMQFNEEALCDIQ-MLIVILPDVTGSIKRICETELGIVSQCCQNK-QYMENVALKINVKTGGRNTVLDDAIRRR-IPLISDRPTIIFGADVTHPPGED-S-S--PSIAAVVASMDWPEITKYRGLVSAQ-THREEIIEDLYKEHLIAFGQKPLRIIFY-RDGVSEGQFSQVLLHEMTAIRKAC-ASLEERYLPPVTFVVVQKRHHTRLFTVVDTKICHPTEFDFYLNSHAGIGTSRPAHYHVLVDENGFTADALQMLTNNLCYTFARCTRSVSIVPPAYYAHLAAFRRYYMEDGGSS-R-LLP-ATKDNV--KDVMFY- Brassica_rapa_BrAGO6 R-LGVGSGRRI-QLCTNHFNVSVLIDQLYKTY-SSDLDGKAFDGEKTLYTV-GPL-PVQIH-FS-A-KIPLTQDAVRVLD-IVLRQQAAERQAFFLN-DVNDVGGGVRGFHSSFRPTDGLSLNIVS-TTMILKGPVIEFLASKVLKNLRVMEFKIIGLSAKPCNQTVYEYFKQTYTEPTYLPCLDVGKP-DR-PYLPLEFCNLVSLQRYTKAQRALLVEKSRQKPLERAM-HTY-CYKDPFL-AGSGISIEKQMTLAEGRVLNPPTLKGRWN--FNKKMLIEPRAIKNWAVVNFSFPRELISGIEIDEKMIAKMH-FILCVLPERKNSWKKVCLTEAGINTQCICND-QYLTNVLLKINSKLGGINSLLGMECSSN-IPLINKIPTLILGMDVSHGPGRA-D-V--PSIAAVVGSKNWPLISRYRAAVRTQ-SPKMEMIDSLFQELFVEFARKPKQIIIF-RDGVSESQFNQVLNIEVDQIIKAY-QRLGETDVPKFTVIVAQKRHHTKLFTVVDTKIVHPTNYDFYMCAHAGIGTSRPAHYHVLLDEIGFSPDELQNLIHSLSYVNQRSTTATSIVAPVRYAHLAAAQAQFTKSEEK----ELP-RLHERV--ESNMFF- Brassica_rapa_BrAGO7 R-PDSGGGSVI-YLLANHFLVKFIKQKLVETEGKDSFSGSAFDGRQNMYSP-VEF-QVSMR-LV-S-KFDGPQEYIHALD-VILRENPTEGRSFYSS-SMGEIGGGSRGFFQSLRQTQGLALNILS-IAAFHEIGVIAYLVEKALKNIRVQRYRVFGLTEEITESRVMSYFDHYGYEIQFLPCLQISR--TR-PYLPMELCVICEGQKFLGKQTAKIMQMGCQRPNERVM-SGPVGPSGKQT-REFNLEVSREMTLLKGRVLQPPKLKRPRS--L----VVKGT---RWALMSIGGSHELTQGVFLSELKLKEIQ-LIICVMERKHKGLKRIAETKIGVVTQCCLNS-QFVSNLALKINAKIGGTMSELYNSIPSH-IPRLLDEPVIFMGADVTHPPFDD-C-S--PSVAAVVGSINWPEANRYVSRMRSQ-THRQEIIQDL--ELLEDFKKLPNRIIFF-RDGVSETQFKKVLQEELQSIKAAC-SNFD-HYNPTITFAVVQKRHHTRLFTVVDTVITHPKEFDFYLCSHLGVGTSRPTHYHILWDENEFTSDELQRLVYNLCYTFVRCTKPVSIVPPAYYAHLAAYRRLYIESGGSM-N-PLP-KLSDNV--KNLMFY- Brassica_rapa_BrAGO9a R-RGTGSGQRI-PLLTNHFKVNFILDKVQQTY-KTDLGSKAYDGEKTLFTV-GPL-PVEIS-YA-A-KIPMLQDAIRVLD-VILRQSAARRQSFFHN-DAQPIGAGVRGFHSSFRTTQGLSLNITS-TTMVVQGPVVDFLARRVLKNLRVREYKISGLSENRCKETVFEYFEFRNIQLQYFPCINVGKP-KR-PYIPIEHCELVSLQRYTKSQRASLVEKSRQKPLERGL-KNS-NYADLVL-QESGVSIGSSFTHVEGRILQAPKLRGRWN--FNNKKLVEPTTVTRWAVVNFSARPDLIRGINVEEKMFEQIK-FLLCILAERKNSWKKKNLAELGIVTQCIAND-QYLTNVLLKINAKLGGLNSLLTMERSQA-MPSVTQVPTIIVGMDVSHGPGQS-D-V--PSVAAVVSSRQWPLISKYRACVRTQ-SRKVEMIDNLFKELLVDFKRKPDHIIIF-RDGVSESQFNQVLNIELDQMMQAC-KFLDEKLNPKFTVIIAQKNHHTKFFTIIDSKICHPRNNDFYLCAHAGMGTTRPTHYHVLYDEINFTTDDLQELVHSLSYVYQRSTTAISVVAPICYAHLAAAQGTVMKSETSS-S-PMP-KLNPEV--ASSMFF- Brassica_rapa_BrAGO9b R-RGSGTGVKT-HLLTNHFRVNFILEKVQETY-RTDLGSKAYDGEKTLFTV-GAL-PVEIS-YA-A-RIPMLQDAIRVLD-VILRQSAARRQSFFHN-DVQHIGGGVRGFHSSFRTTQGLSLNITS-TTMVVQGHVVDFLARRALKNLRVREYKITGLSEERCQDTVYKYFEFRGIPLRYFPCINVGKP-KR-PFIPIEHCELVSLQRYTKSQRASLVEKSRQRPPERGL-KKS-NYADLVL-QESGVSIGSSFTQVEGRVLPAPRLKGRWN--FNYKKLVEPVTVTKWAVVNFSARSDLIRGINVEEKMFEQMK-FILCILAEKKNSWKRRNLVEEGIVTQCIAND-QYLTNVLLKINAKLGGLNSLLAMERSRAMMPLVTQVPTFIVGMDVSHGPGQS-D-I--PSFAAVVGSIEWPLISKYRACVRTQ-SRKVEMIDNLFKELLWDFKRKPEHIIIF-RDGVSESQFNQVLNIELDQMMQAC-KFVEENWEPKFTVIIAQKNHHTKFFTIIDSKICHPRNNDFYLCAHNGMGTTRPTHYHVLYDEIGFSTDDLQELVHSLSYVYQRSTTAISVVAPVCYAHLAAAQGTVMKSETSL-T-PMP-KLNVNV--ASSMFF- Brassica_rapa_BrAGO9c R-RGIGSGVRT-PLLTNHFRVNFILEKVQETY-RTDLGSKAYDGHKNLFTI-GAL-PVEIS-YA-A-RIPMIQDATRVLD-VILHQNAARRQSFFHN-DARNIGGGVRGFHTSFRTTQGLSLNITS-TTMVVQGPVIDFLARRALKNLRVRECKITGLSEERCKYTVYNYFEIRGLKLRYFPCINVGKA-NR-PYIPIEHCELVSLQRYTKSQKASLVENSRQSPPERSM-KKS-NYADLVL-QESGVSIGSSFIQVEGRVLPAPRLRGRWN--FNKKKLVEPVTVTRWVVVNFSAESDLIRGMNVEEKMFEQIK-FILCILAEKKNSWKKKNLIEHGIVTQCIAKD-QYITNVLLKINAKLGGLNSLLAMERSRAMMHLVTQVPTFIVGMDVSHGPNQA-D-I--PSIAAVVGSREWPLISKYRACVRTQ-SRKMEMIDNLFKELLFDFKRRPEHIIIF-RDGVSDSQFNQVLNIELDQIMQAC-KFVEENWEPKFTVIIAQKNHHTKFFTIVDSRICHPHNNDFYLCAHAGLGTTRPTHYHVLYDEIRFSTDDLQELVHSLSYVYQRSTTAISVVAPICYAHLAAAQGTVMKSERSS-I-PMP-MLNSDV--ASSMFF- Capsella_rubella_CrbAGO1 R-PGKGQGKRC-IVKANHFFAELVMKQLVDSYRESHLGKRAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPTSGRSFYSP-NIGSLGDGLRGFYQSIRPTQGLSLNIMS-STAFIESPVINFVIKKALRGVKVRKYRISGLTAVATRESVVEYFETYGFRIQHLPCLQVGNS-NR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPLERTV-ELN-NYKDPYA-LEFGIKISTSLASVEARILPPPWLKGQWN--MMNKKMINGGTVNNWICINFSRQQELAQGMAFNEKVLKTRD-LLIVILPDNNGSLKRICETELGIVSQCCLSK-QYMANVALKINVKVGGRNTVLVDALSRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEITKYAGLVCAQ-AHRQELIQDLFKELLIAFGHKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEAGYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSM-A-PLP-ALKENV--KRVMFY- Capsella_rubella_CrbAGO10 R-PGFGTGTRC-IVKANHFLADLIIAELVRLYKESDLGTRAYDGRKSLYTA-GEL-PVAIK-FV-A-RANMPQEALQILD-IVLRELSVKGRSFFSP-DIRRLGEGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIEFVIKKGLRGVKVRKYRVAGLTTQPTRESVIEYFEMYGFTIQHLPCLQVGNQ-KK-AYLPMEACKIVEGQRYTKRQITALLKVTCQRPRDRTV-QHN-AYQDPYA-KEFGMNISEKLASVEARILPAPWLKGQWN--MMNKKMINGMTVSRWACVNFSRSNELGQGMEFNEKALKHVE-LLLAILPDNNGSLKRICETELGLISQCCLSK-QYLANVSLKINVKMGGRNTVLLDAISCR-IPLVSDIPTIIFGADVTHPNGEE-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKDLLISFGQKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFIVVQKRHHTRLFTVVDTKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFTADGIQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDNGSP---PLP-ALKENV--KRVMFY- Capsella_rubella_CrbAGO2 R-PDRGGVRRV-NLYVNHFRVHFVRDKVFTDN-PGKFPFAAYDGQKNIFSA-AEL-PFTIK-QV-N-ELKLPRDVLQGMD-VVMKEHPSKGKSFFTR-ETADLGFGVKGYRHTLKPTQGLSLCLYS-VLAFRKMSVIEYLVERELTGLKVQKLTIVGLSLQDTKDSIVDYFIKYGRDIVHIPCLDLGKN-GR-QLVPMEFCDLVEGQIYPKDSALWLKKLSLVNPQQRMI-KSRNGPGGEII-RNFGLKVDTNMTHVEARVLKAPTLKNQWN--LMKKGVTRGSIVKHWAVLDFTAYDNLIDGMQMEEELLQSVT-LVLCAMSGRVDGLKWIAETKLGLVTQCFLGD-QYRANLALKMNAKVGGSNVELMDT---T-FSFFKEDEVMFIGADVNHPARDK-M-S--PSIVAVVGTLNWPAANRYAARVIAQ-PHRKEEIQGF--ELVKAHGKRPNKIVIF-RDGVSDAQFDMVLNVELLDVKLTF-EKA--GYNPKITVIVAQKRHQTRFFTVLDTKVIHPYEYDFYLCSHHGGGTSKPTHYYTLWDELGFTSDQVQKLIFEMCFTFTRCTKPVSLVPPVYYADMVAYRRMYHEEKNVR-Q-AIF-KLHAEL--ENVMFF- Capsella_rubella_CrbAGO3 R-ADQGGVRRV-NLLVNHFKVNFVKEKAFRDN-PDKFP-DAYDGQNNIFSA-TNLPPFTMK-KV-N-ELKLPREVLQGLD-VVMKEHPSKGKSFFSH-ET-CRNGGFQGFRHALKPTVGLSLCLSS-VMAFYPLLVIEYLFEKELKGLKVPRFTIKGLSVQNTKDSIVNYFNKYQKNIQHLPCLDLGKN-GR-QLVPMELCFLVEGQIYPKESENWLRNLSIVHPEKRMI-TSPDGPGGDII-GKFGLQVDTNMTHVVGRVLEPPMLMNQWS--LMKKRVAEGSTVEHWAVLDFTASDKLIEGMQMDEELLQSVT-LVLCAMSWRDNGLKWIAETKLGLVTQCFLLD-QYLANLALKMNAKTGGNNFHLRDT---T-FSFFKEDEVMFIGADVNHPARDE-E-S--PSIAAVVGTLNWPKANRYASRVISQ-AHRQEEIQGF--ELVKAHGKRPNKIVIF-RDGVSDAQFDMVLNVELRDVKLSF-EKD--GYNPKITVIVAQKRHQTRFFTVVDTEVIHPSKRDFYLCSHHGGGTSKPTHYYTLWDELGFTSDQIQKLIFEMCFTFTRCTKPISLVPPVKYADMVAYRRFYYDEKNSK-Q-TVF-KVNRLI--EDSMFF- Capsella_rubella_CrbAGO4 R-KGFGTGQKI-PLLTNHFKVDVILDKVHETY-HSDLDGKAYDGEKTLFTY-GAL-PVEIS-YA-A-KIPLSQEAIRVLD-IILRQHAARRQSFFHN-DPSPVGGNIRGFHSSFRTTQGMSLNMVT-TTMIIKGPVVDFLAKRTLKNLRIQEFRITGLSDKPCKETVADYFDTRHIDLQYLPCINVGKP-KR-PYIPLELCALIPLQRYTKAQRSALVEKSRQKPQERAL-KVS-NYTEPLL-RSCGISISSNFTQVEGRVLPAPKLKGRWN--FNNKQFVEPTKIERWVVVNFSARDDLIKGIEIAENMFKDIQ-FILCVLPEKKNCWKKKNLTEYGIVTQCMAND-QYLTNLLLKINAKLGGLNSMLSVERTPA-FTVISKVPTIILGMDVSHGPGQS-D-V--PSIAAVVSSREWPLVSKYRASVRTQ-PSKAEMIESLFKELLVDFKRKPEHIIIF-RDGVSESQFNQVLNIELDQIIQAC-KFLDEKWNPKFLLLVAQKNHHTKFFTIIDNKICHPKNNDFYLCAHAGMGTTRPTHYHVLYDEIGFSPDELQELVHSLSYVYQRSTSAISVVAPICYAHLAAAQGTFMKSETSS-S-QLP-KLKDNV--ANSMFF- Capsella_rubella_CrbAGO5 R-PGRGTGRKI-TVRANHFLVQVVMKALVSMYKESHLGGKAYDGRKSIYTA-GAL-PVAIKQVA-S-RPDLPYDVIQLLD-VVLRDQPSKGRSFFST-VFGELGDGVRGYFQSLRLTQGLSLNIVS-ARSFYEIVVTDFIVKKVLKTVKVKTAKITGISTCPISQTVVQYFERYNHRVRYLPAIQTGND-SR-PYIPMELCQIVGEQRYTKRQVTALLKATCQRPEERLV-VGN-KYS--PLVKEFGMSVTSQLASIEARVLPPPMLKGQWN--MINKKMVNGARVDRWTCVNFSRRYQLTEGMQFNEEALHDIQ-LLIVILPDVTGSIKRICETELGIVSQCCQNN-QYMENVALKINVKTGGRNTVLNDAIRRN-IPLITDRPTIIMGADVTHPPGED-S-S--PSIAAVVASMDWPEITKYRALVSAQ-AHREEIIQDLYKEHFIAFGQIPSRIIFY-RDGVSEGQFNQVLFHEMNAIRKAC-NSLQKDYLPRVTFVIVQKRHHTRLFTVVDTQICHPNEFDFYLNSHAGIGTSRPAHYHVLYDENGFSADAMQTLTNNLCYTYARCTKAVSIVPPAYYAHLAAFRRYYMEDGGSS-R-KLP-AVKDNV--KDVMFY- Capsella_rubella_CrbAGO6 R-LGVGTGNPI-ELCTNHFNVSVLMDQLFKTY-SSDLDGKAYDGEKSLYTV-GPL-PVQIH-FV-T-KIPLAQDALRVLD-TVLRQQAAERQAFFHN-NGYDIGGGARGFHSSFRPTHGLSLNIVS-TTMIVEGPVIEFLAAKMLKNMRVMEFKIIGLSQKPCNQTVYDYFKQTYTQPTSLPCLDVGKP-NR-PYLPLEFCNLVSLQRYTKAQRASLAEKSRQKPLDRAM-HT---YKDPFL-AGCGISIEKQMTQVEGRILKPPMLKGRWN--FNNKMLLEPRPIKNWAVVNFSFPRELISGIEIDEKMIAKMH-FILCVLPERKTSWKKICLTDEGINTQCICSD-QYLTNVLLKINSKLGGINSLLGIEYSYN-VPLINKIPTLILGMDVSHGPGRA-D-V--PSVAAVVGSKCWPLISRYRAAVRTQ-APRLEMIDSLFQELFVEFARKPKQIIIF-RDGVSGSQFNQVLNIEVDQIIKAY-QRLGESDVPKFTVIVAQKKHHTKLFTVVDTKIVHPTNYDFYMCAHAGIGTSRPAHYHVLLDEIGFSPDDLQNLIHSLSYVNQRSTTATSIVAPVRYAHLAAAQAQFNRLEDGK---ELP-RLHERV--ESNMFF- Capsella_rubella_CrbAGO7 R-PDSGGGSVI-YLLANHFLVKFIKQKLVETE-RNSFSGVAFDGRKNIYSP-VEF-QVNMR-LV-S-KFDGPPEYIHALD-VILRENPMEGRSFYSS-SMGEIGGGARGFFQSLRHTQGLALNMLS-ITAFHEIGVIAYLVEKALKNIRVQRYRVYGLTEEITENRLMSYFDHYGYEIQYLPCLQISR--AR-PYLPMELCMICEGQKFLGKQAAKIMKMGCQKPNERVM-AGSVGPSGNQT-REFNLEVSKEMTLLKGRILLPPKLKRPKN--LKESRVLKGTRIERWALMSIGGSNELTQGVFLSESKLKEIQ-LLICVMEKKHKGLKRIAETRIGVVTQCCLSS-QFVSNLALKINAKIGGSMTELYNSIPSH-IPRLHDEPVIFMGADVTHPPFDD-C-S--PSVAAVVGSINWPEANRYVSRMRSQ-THRQEIIQDL--ELLDDFNKLPNRIIFF-RDGVSETQFKKVLQEELQSIKAAC-SKFQ-DYNPSITFAVVQKRHHTRLFTVVDTVITHPNEFDFYLCSHLGVGTSRPTHYHILWDENKFTSDELQRLVYNLCHTFVRCTKPISIVPPAYYAHLAAYRRLYIEM-NHH-H-PLP-KLSDNV--KNLMFY- Capsella_rubella_CrbAGO8 R-RGHGSGRKI-NLLTNHFSVDFILEKVQQTY-QTDLDFKAYDGDKSLFTV-GPL-PVAIS-FA-A-KIPMIQDMIRAMD-VILGQNAARRQSFFYN-DAKNVGEGVKGFHSSFQNTQGLSLKIVS-TTMIIKGAVVDFLAKSALKNLRVREYKITGLSELRCKDTVFDYFKMRDIKLHYLPCINVGKP-NRPPYFPIELCELVSLQRYTKAQRSNLVKEARQKPQQNAC-KNS-NYDDPML-QDCAVRIGSGLTQLHGRVLPTPKLKGSWN--FIDKKFFEPATVTRWAVVNFSARRELIRGINVDDKMFEYLK-FLLCIL-EKKNSWKKKNLVQFGIVNQCIVKE-QYLINVLLKINAKLGGLNSILDMEQTRA-MPLVMRVPTIIIGMSISHGPGQS-D-A--PSIAAVVSSREWPFISKYKACVRTQ-TRKAEIIENLFKELLLDF-VKPNHIIIF-RDGVSESQFNRVLNIELDQMM--------------------QKNHHTKFFTIVDSNICHPRNNDFYLCAHAGKGTTRPTHYHVLYDEIGFNTDNLQELVHSLSYVYQRSTSAISLAAPICYAHLAASQATAMKSETSP-S-PMP-KLNTKV--SGSMFF- Capsella_rubella_CrbAGO9 RPRGSGTGQKI-PLLTNHFGVKFILDKVQETY-RSDLGAKAYDGEKTLFTV-GAL-PVEIS-YA-A-KIPMLQDAIRVLD-IILRQSAARRQSFFHN-DVKPIGGGVRGFHSSFRTTQGLSLNITS-TTMIVQGPVVDFLARRVLKNLRVREYKISGLSEQSCKDTVLDYYE-RNIEVRYFPCINVGKP-KR-PYFPIEFCNLVSLQRYTKSQRAALVEKSRQKPPERGL-KDS-NYADPVL-QDSGVSIISDFTKVEGRILPTPKLKGRWN--FNNKKLVEPTTVTRWAVVNFSARRDLIRGINVEENMFEQIL-FLLCILSERKNSWKKKNLVDLGIVTQCIAND-QYLTNVLLKINAKLGGLNSLLAMERSPA-MPKVTQVPTIIVGMDVSHGPGMS-D-I--PSIAAVVSSRQWPLISKYKACVRTQ-SRKMEMIDNLFKELLLDFKRKPEHIIIF-RDGVSESQFNQVLNIELDQMMQAC-KFLDENWNPKFTLIVAQKNHHTKFFTIIDSQICHPRNNDFYLCAHAGMGTTRPTHYHVLYDEIGFATDDLQELVHSLSYVYQRSTTAISVVAPICYAHLAAAQGTVMKSETSS-S-PMP-QLNDKV--ATSMFF- Carica_papaya_CpAGO1 R-PGYGQGTKC-VVKANHFLAQMIMTQLVKVHRDNELGMRVYDGGRNLYTA-GFL-PVTIK-FV-A-VASMPQEAINVID-IVLRELAAQGRFLYSP-ELKQLGGGLRGFYQSIRPTQGLSLNIMS-TTAFIELPVIEFVVKKALRGVKVRKYRISGLTSQPTRESVVEYFEMYGYTIQYLPCLQVGNP-RK-IY?????????????????QITSLLKVSCQRPCEQTI-RQN-AYRDPYA-KEFGINIDSKLASIEARVLPPPWLKGQWN--MMNKKVINGSSVRYWACINFSRSQQLVQGMEFNKKALKYVE-LLIAILPDNNGSLKRICETDLGLISQCCLSR-QYLANLSLKINVKMGGRNTVLLDALSWR-IPLVSDIPTIIFGADVTHPTGED-S-N--PSIAAVVASQDWPEVTKYAGLVCAQ-PHRQELIQDLYK-----------------RDGVSEGQFYQVLLFELDAIRKAC-ASLEPGYQPPVTFVIVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADEIQTLTNNLCYTYARCTRSVSVVPPAYYAHLAAYRRFYMEDNAKT---PLP-ALKEKV--KNVMFY- Carica_papaya_CpAGO10 R-PGYGQGTKC-IVKANHFFAELIIAELVRLYKESDLGMRAYDGRKSLYTA-GEL-PVVIK-FV-A-RANMPQEALQILD-IVLRELSNKGRSFFSP-DIRRLGEGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVVEFVIKKALRGVKVRKYRVAGLTSQPTRESVVEYFEMYGFTIQHLPCLQVGNQ-KK-AYLPMEACKIVEGQRYTKRQITSLLRVTCQRPRDRTV-QHN-AYQDPYA-KEFGIKISEKLASVEARILPAPWLKGQWN--MMNKKMINGMTVTRWACINFSRSHELAQGMEFNEKALKHVE-LLLAILPDNNGSLKRICETDLGLISQCCLSK-QYLANVSLKINVKMGGRNTVLLDAISCR-IPLVSDIPTIIFGADVTHPNGED-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKDLLVSFGQKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPDYQPPVTFIVVQKRHHTRLFTVVDSKICHPSEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADGMQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRRFYMEENGMT---PLP-ALKENV--KRVMFY- Carica_papaya_CpAGO2 R-PDEGGIHTA-RLRVNHFLVKFIRKKLFTDN-PIKFPLSAYDGEKNIYSL-VPL-ECTIK-LV-N-ELKLPRDILQGMD-VVMKENPTKGRGFHFI-NPDDLGFGLRGYRHSLKPTSGLALCVYS-VLAFWKMPVIEFLVANALTNLKVQKYTIVCLTKERTKNSIVDYFEKYGRDIVHIPCLDLGKN-NR-AYVPMEFCVLVEGQIYPKEAAWRLKNMSLAKPEDRIV-GATDGPSGYGI-RNFGIEVDVNMTSVIGRIIRPPDLKCQWN--LLGKGVVEGKPVERWAVLDFSSSPKLINGMHMKYELLESVQ-FILCVMSRKDPGLKWISETRTGVVTQCCLND-QYLANLALKINAKLGGSNVELVD----A-LAHFREDHVMFVGADVNHPARNT-T-S--PSIAAVVATINWPAANQYAARIRAQ-NHREERIVNY--DLAETYGVKPKKVVVF-RDGVSEGQFDMVLNEELLDMKDAF-QKV--SYFPNITIVVAQKRHQTRFFTVVDTKIIHPFEFDFYLCSHYGSGTSKPTHYHVLWDENGFSSDQLQKLIYDMCFTFARCTKSVSLIPPVYYADLVAYRRLYHEKQSPP-S-KFY-KVHADL--ENIMFF- Carica_papaya_CpAGO4 R-RGVGSGQKI-QLLTNHFKVNVLIDKVQETY-HSELDGKAYDGEKSLFSA-GPL-PVEIS-FA-A-KIPMSQEALRVLD-IILRQHASRRQSFFHN-DPKDVGGGVRGFHSSFRASQGLSLNIVS-TTMIIRGPVVDFLAKRTLKNLRIQEYKITGLSERPCKETVYDYFNTRGIELRYLPCINVGKP-KR-PFIPLELCSLVPLQRYTKAQRASLVEKSRQKPQERAL-RNS-NYSEPML-RQCGISISTNFTQIEGRVLPAPRLKGRWN--FNNKKLAEPTKIERWAVVNFSARRDLIKGIRLEEKMFEEIE-FLLCLLPERKNCWKRKNLAEFGIVTQCIAND-QYLTNVLLKINAKLGGLNSILAIEHSPA-IPIVSKAPTIILGMDVSHGPGQS-D-V--PSIAAVVSSRQWPLISRYRASVRTQ-SPKVEMIDSLFKELLLDFKRKPDQIIIF-RDGVSESQFNQVLNIELDQIIEAC-KFLDESWSPKFLVIIAQKNHHTKFFTVIDSKICHPRNNDFYLCAHAGMGTTRPTHYHVLLDEIGFSADDLQELVHSLSYVYQRSTTAISVVAPVCYAHLAATQGQFIKSETSS-S-QLP-RLKENV--SSSMFF- Carica_papaya_CpAGO5 R-PGVGKGYKC-QIRANHFLVEFVIEELVVSCRASHLNNRAYDGRKFLYTA-GAL-PVALK-LA-G-KADLPYETIQALD-IVLRQMASKGRSFFSP-DM-NLGDGVWGHYQSLRPTQGLSLNILS-ATAFYQILVTDFLVRRALKLLKVRAYKIFGISDQPLSESVVQYFEKYKTKLKFLPAIQAGSV-SS-PFLPMEVCQIADRQRYTKKQITNLLRATCRRPNQRIA-QSV-KFDALVT-TEFGIHVGRELAKVEARVLRSPTLKGQWN--MINKKMVNGGRVEFWTCVNFSEQRQLIEGMEFNERVLVDIQ-LLIVILPDVTDSIKRVCETELGIVSQCCQSK-QYFENIALKINVKAGGRNTVLDDAIEGR-IPFLTDRPTIILGADVTHPPGND-S-F--PSIAAVVASMDWPEATKYRGIVSAQ-SHREEIIQDLYK--------------------------------------RAC-ASLEEGYLPPVTFIVVQKRHHTRLFTVVDTKICHPREFDFYLNSHAGIGTSRPVHYHVLWDENKFTADALQVLTNNLCYTYARCTRAVSIVPPAYYAHLAAFRRYYLEDSESA-S-PLP-SIKDNV--KNVMFY- Carica_papaya_CpAGO6 R-PGSGRGNRI-PLLSNHFKVSVIMDRLYQTY-SSELAGKAYDGGKSLYTV-GPL-PVEIR-YA-A-KIPLTQDALRVLD-IVLKQKAANRQSFFHD-DPKDLGGGVRGFHSSFCTTQGLSLNTVS-TTMILKGPVIDFLALSPYKEHRW------------------------------------GKS------LAIE-CKLLLMLRFLTFLFCSSESCNALTPLN-AV-GNN-HHQEVVL-TECGISIDRQLMQVDGRILETPKLKGRWN--FNNKTLLKPTYIDSWLVVNFSARRELISGIHIEDRMFEQMK-FILCVLPERKNSWKKKCLCDYGIVTQCISND-QYLTNVLLKINSKLGGINSLLAIEASPH-IPLIRDIPTMILGMDVSHGLGQL-D-I--PSIAAVVGSRCWPLISRYRASVRTQ-SAKMEMIDALFKELLVDFGRKPKQIILF-RDGVSESQFNQVLNIEVEQIIKAY-QNLGEVDVPKFTVIVAQKNHHTKLFTIVDTKIVHPRTYDFYLCAHAGMGTSRPAHYHVLIDEIGFNPDDLQNLIHSLSYVYQRSTSAISIVAPVYYAHLAAQQSQFLKSETSS-G-ELP-RLAKEV--ESSMFF- Carica_papaya_CpAGO7 R-PDSGGGPVI-SLLANHFLVQFIKQKLVQDN-PVTLSGAAYDGRKNLYSP-IEF-QINIR-LV-S-KLDGPQDYLHALD-VVLRESPTEGRSFYSS-SMGEIGGGARGFFQSLRPTQGLALNVFS-VTAFHEIGVIPYLVEKALRNIRVQRYRVYGLTEEATENRLLTYFDHYNYDIQFLPCLQISR--SK-PYLPMELCMICEGQKFLGKQTARILKMACQRPKERVM-GGPVGPSGNQG-REFKFNVSREMTRLSGRILQPPKLKRQWN--LLDSHVFEGTRIERWALISFGGTNQLSQGIFLNESKLKKIQ-LLMCIMERKHKGLKRIAETSVGVVTQCCLSS-QFLANLALKMNAKVGGCTVALYNSLPSQ-IPRILDEPVMFMGADVTHPPLDD-F-S--PSVAAVVGSMNWPAANKYVSRMRSQ-THRQEIIQDL--ELLDDFTQLPKRIIFF-RDGVSETQFNKVLKEELQAIREAC-SRFP-GYRPPITFSVVQKRHHTRLFTVVDTVITHPREFDFYLCSHWGVGTSRPTHYHVLWDENHFTSDELQKLVYNLCYTFVRCTKPVSLVPPAYYAHLAAYRRLYLETASVR-N-PLP-KLRENV--KKLMFY- Chlamydomonas_reinhardtii_CrnAGO2 R-PGYSAGKTI-QVLTNHVPLNVVLVALLGDTGAGGSGAAVFDGSQALYG-------VDLK-LV-G-ALDVGAAALAVLD-LVTRAGVAWGGSYVSYKQEDPVKGLLRGFRSAVAQVAGTTLTIAA-SAVVAGGPLLGQLLEEALVGLEVNRYKLSGKLGKSARSSV-----------QHLPCVLD----KK-GALPIELLTVVKYQKRMSRQKADYIRTAALKPADRAL-TRQLGSRGQVA-RAFGLAPFNDMLKVPAQLLPGPLLQGEWA----GGGVAVAPEWRSGAVLCYLSQAALSKSASALEFWLNRAQ-MVMVVLPDRGGVIKAAGDGKLGVATQCVNSF-SYAAQLALSVNAKLGGATTRPAGRPNDW-LPLLGGRRLMVSGALLSRGRGAA-QVSAGVEYAAVVGSAD-SHAVDYRVQLSAQVAGNRDIVVSM-------------VVLMY-RDGLSESQFDRALAEEFTAIVQAC-ADVGGSYRPRICFVVVQKSHNTRFFTAVDRGVTDPHAFDFFLNSHAGIGTNRAPRYTVLVDEVGFTAEALQLLTHTLCHTYPACTRALSLPPPVRYADRAADRRTLRYPSGKQ-G-MLP-TLPGHV--------- Chlamydomonas_reinhardtii_CrnAGO2like R-PGYSAGKTI-QVLTNHVPLNVVLVALLGDTGAGGSGAAVFDGSQALYGVEGDL-RVDLK-LV-G-ALDVGAAALAVLD-LVTRAGVAWGGSYVSYKQEDPVKGLLRGFRSAVAQVAGTTLTIAA-SAVVAGGPLLGQLLEEALVGLEVNRYKLSGKLGKSARSSVQTYFERYGVSLQHLPCVLD----KK-GALPIELLTVVKYQKRMSRQKADYIRTAALKPADRAL-TRQLGSRGQVA-RAFGLAPFNDMLKVPAQLLPGPLLQGEWA----GGGVAVAPEWRSGAVLCYLSQAALSKSASALEFWLNRAQ-MVMVVLPDRGGVIKAAGDGKLGVATQCVNSF-SYAAQLALSVNAKLGGATTRPAGRPNGE-LALA-----------LPRTRTRV-QVSAGVEYAAVVGSAD-SHAVDYRVQLSAQVAGNRDIVVSM--RLLLQYSELPEVVLMY-RDGLSESQFDRALAEEFTAIVQAC-ADVGGSYRPRICFVVVQKSHNTRFFTAVDRGVTDPHAFDFFLNSHAGIGTNRAPRYTVLVDEVGFTAEALQLLTHTLCHTYPACTRALSLPPPVRYADRAADRRTLRYPSGKQ-G-MLP-TLPGHV--------- Chlamydomonas_reinhardtii_CrnAGO6 R-PSAGSGKAV-ALLANYFALATVMASAAAAH---GWPAGRFDGRKNLFLP-GELLPVTTK-WA-A-CVGLPRDAMQVLD-IVIRHAFAIGRGFYYG-GEGPLGGGASGFQQSFKAVQGLTLNLSS-FAAFMSRPLPELL------GAGVRRKALVGLSEQGADRSVAEYF-STGRPLRHLPCANVGDR-RR-AFIPVELCTVVAGQRRMK-QSAGMITAAKQDPAVKQAKRVAEALAGGTD-RCWGLKLATGMLPVQGRMLPNPVLH--------NVKFVDPRALDSWGVAVMMNQEDLTGGMRVAEATMRAAQ-LVLVVLPE-KTAVKRVSDIELGIPSQVVVGP-QYCANVAMKINNKLGGVNVQLSGGL-RN-MPVLGAVPFMVLGADVTHPRADS-R-D--PSVAAVVASLD-ASLGRWASRVLLQ-AGRQEVITGM--ELLLEFQVKPQRLVMY-RDGVSEGQFEQVLAEEYTALRRAC-RELEEGYRPAITFVVVQKRHNTRLLTVVDSGITAPDGFDFYLNSHAGLGTNKPAHYHVLVDEIGFGADGIQLLTYWLCYLYQRTTKSVSYCPPAYYADRAAFRRTLLAASDSA-S-TFA-GIHRNL--TNVLYF- Chlamydomonas_reinhardtii_CrnAGOlike R-RGCFSGQSA-LPCTSAAAAPAVLDSAARTRAPAASPGVRVELASSVTRP-SPI-PITTG-ATGS-ETSLAADVQRYLDQAAAAHAAAEGECDFSRREPGSISHRVRGGDAANKPAGGASASDEE-VGADDDAAVPSWVAQQPLWDAQVLQHEVEAMAEATAEALLANYFQAYHYDVEIVEEAAGGE------LLPREVLKPREGDKSERDLQDYLAQRQQTAPRDAAK-RVAEALAGGTE-RSWGLKLGTGMLPVQGRVLPNPVLQGSWN--TLNVKFVDARALDSWAVAVMMNQ------------------------------------------------GP-QYCANVAMKINNKLGGVNVQLSGGL-RY-MPVLGSVPFMVLGADV-----------------------------------------------------------KPQRLVMY-RDGVSEGQFEQVLAEEFTALRRAC-RELEEGYRPAITFVVVQKRHNTRLLTVVDSGITAPDGFDFYLNSHSGLG-----------------------------------------------------------------G-----RFQPKL--ANPM--- Citrus_sinensis_CsnAGO1 R-PGRGSGTRC-IVKANHFFAELVMEQLVKLYRESHLGKRAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPTTGRSFYSP-DLGPLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVIKKALRGVRVRKYRISGLTSQTTGESVVEYFETYGFVIQHWPCLQVGNQ-QR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPHERTV-HHN-AYEDPYA-REFGIKISEKLASVEARILPAPWLKGQWN--MMNKKMVNGGTVNHWICINFSRHFELAQGMAFNEKVLKTRD-LLIVILPDNNGSLKRICETDLGLVSQCCLSK-QYMANVALKINVKVGGRNTVLVDAISRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLFKELLISFGQKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFTADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSM-T-PLP-ALKENV--KRVMFY- Citrus_sinensis_CsnAGO10 R-PGYGQGTKC-IVKANHFFAELIMAELVRLYKESDLGMRAYDGRKSLYTA-GEL-PVVIK-FA-A-RANMPQEALQILD-IVLRELSTKGRSFFSP-SIRRLGDGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIEFVIKKALRGVKVRKYRVSGLTSQPTRESVVEYFEMYGFTIQHLPCLQVGNQ-KK-AYLPMEACKIVEGQRYTKRQITALLKVTCQRPRDRTV-QQN-AYQDLYA-KEFGIKISEKLASVEARILPAPWLKGQWN--MMNKKMINGMTVSRWACINFSRSNELAQGMEFNEKALKHVE-LLLAILPDNNGSLKRICETDLGIISQCCLSK-QYLANVSLKINVKMGGRNTVLLDAISCR-IPLVSDIPTIIFGADVTHPNGED-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKDLLISFGQKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFIIVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRRFYMEENGST-D-PLP-ALKENV--KRVMFY- Citrus_sinensis_CsnAGO4 R-RGLGSGQRI-SLLTNHFKVNVVIDRVQETY-NAELDGKAYDGEKSLFTV-GPL-PVEIS-FA-A-KIPISQEAFRVLD-IILRQHAAKRQSFFHN-DPKDVGGGVRGFHSSFRTTQGLSLNIVS-TTMIIQGPVVDFLAKRTLKNLRIQEYKITGLSEKLCKETVYDYFNNRNIDLRYLPCINVGKP-KR-PYIPLELCELVSLQRYTKAQRASLVEKSRQKPQERAL-KLS-KYNEPML-RSCGISISTNFAQVEGRVLPAPRLKGRWN--FNNKKLVQPTKIERWAVVNFSARRDLIKGILIDEKMFDEIQ-FLLCLLPERKNSWKRKNLADFGIVTQCMAND-QYLTNVLLKINAKLGGLNSLLAVEHSPS-IPIVSKVPTIILGMDVSHGPGHS-D-I--PSIAAVVSSRHWPLISRYRAAVRTQ-SPKVEMIDSLFKELLLDFKRKPEQIIIF-RDGVSESQFNQVLNVELNQIIEAC-KFLDEKWSPKFAVIVAQKNHHTKFFTVVDNKVCHPRNYDFYLCAHAGMGTSRPTHYHVLFDEIGFSSDELQELVHSLSYVYQRSTTAISVVAPICYAHLAASQGSFMKSETSS-S-QLP-RLQEKV--CNSMFF- Citrus_sinensis_CsnAGO5 -------------------MVQLIISQLINLYRLTDLGGRAYDGMKSIYTA-GPL-PVVIR-LA-S-KPDLPYDVIQVLG-VILSAASSEGRSFFPT-DHGQLGDGVRGYFQSLRLTQGLSLNIVS-ARSFYEILVTEFVVKKELKGIKVNSHRITGISSQPMSQSVIQYFERYNIALQFLPALLAGSE-AR-PYLPMELSRIVAGQRYTQRQVTALLQATCQRPRERMA-RAN-AYEDTLVNKEFGIQVADDLTSVDARILPAPMLKGQWN--MINKKMFNGGRVEVWTCVNFSTRQGLVDGMVFNEKALVDVQ-LLIIILPDVSGS----------------VD----------RFASLVGGRNTVLVDAVQKR-IPLVTDRPTIIFGADVTHPPWGG-T-S--PSIAAVVASMDWPEVAKYRGLVSAQ-APHEEIIQDLYKELLIAFNFKPHRIIFY-RDGVGERQFSQVLLHEMNAIRQAC-ASLEEGYAPPVTFVVVQKRCRTRLFTVVDTEICHPTEFDFYLNSHAGIGTSRPTRYHVLYDENRFTADGLQVLTNNLCYTYARCTRSVSIVPPAYYAYLAAFRRYYIEAGGST-D-PLP-VIKDNV--KDVMFY- Citrus_sinensis_CsnAGO6 R-RGVGNGRRI-SLLTNHFKVSVVVDKLYQTY-SAELAGKAYDGEKSLYTV-GPL-PVEIS-FA-T-KIPLTQDALRVLD-IVLRQQAANRQSFFHD-DSRDVGGGVRGFHSSFRPTQGLSLNMVS-TTMILKGPVIDFLAKKMLRNLRVMEFKIVGLSEKPCNQTVYDYFQHCRIELTYLPCLDVGKP-KR-PYLPLELCSLVSLQRYTKAQRASLVEKSRQKPQDRAL-RSY-SYEDPVL-AACGISIGKQLTQVDGRILEIPKLKGRWN--FNNKRFLEATRIDRWIVVNFSARRELINGIHIEERMFELIQ-FILCVLPERKNSWKKKSLSDFGIATQCISND-QYLTNVLLKINSKLGGINSLLALEQSSL-IPLIKDTPTMILGMDVSHGPGRS-D-I--PSVAAVVGSQSWPLISRYRAAVRTQ-SSKVEMIDALYKELLLDFQRKPKQIIIF-RDGVSESQFNQVLNIELEQIIKAY-QHLGEADIPKFTVIVAQKNHHTKLFTVVDTRIVHPRNYDFYMCAHAGMGTSRPAHYHVLLDEIGFSPDDLQNLIHSLSYVYQRSTTAISIVAPICYAHLAASQGQFIKSDTS----ELP-RLHKNV--ESSMFF- Citrus_sinensis_CsnAGO7 R-PDAGGGAVI-SLLANHFLVQLIKQKLVEEN-SSMLSGAAFDGRKNIYSP-VEF-EINIK-LV-S-KYDGPQDYLHALD-VVLRENPSEGRSLYSS-SMGEIGGGARGFFQSLRPTQGLSLNVSS-VSAFHEVGVIPYLVERALKNIRVQRYRVYGLTEEVTENRLLSYFDHYNYNIQFLPCLQISR--SK-PYLPMELCMICEGQKFLGKQTARILKMGCQRPKERVM-RGPVGPSGNQG-REFKLHVSREMTRLNGRILQPPKLKRQWN--FLESHVFEGTRIERWALLSFGGSCQLSQGIFLNESKLKKIQ-LLICVMERKHKGLKRIAETSVGVVSQCCLSS-QFLANLALKINAKVGGCTVALYNSLPSQ-IPRLPDEPVIFMGADVTHPPLDD-F-S--PSVAAVVGSMNWPAANKYASRMRSQ-THRQEIIQDL--ELLDDFNKLPRRIIFF-RDGVSETQFYKVLQEELQSIREAC-SRFP-GYSPPITFVVVQKRHHTRLFTVVDTVITHPREFDFYLCSHWGVGTSRPTHYHILWDDNKFTSDELQKLVYNLCYTFVRCTKPVSLVPPAYYAHLAAYRRLYLEATLMG-S-PLP-KLSENV--KKLMFY- Citrus_sinensis_CsnAGO9 R-RNHGTGTPM-TLLTNHFEVRMILDKVQETY-SHELEGKAYDGEKSLFTL-GSF-QVEIS-YA-A-KIPMFQEAMRVLD-IILRQNAANRQSFFHN-NPRDLGGGVRGFHSSFRATQGLSLNMVS-TTMIVKGPVVNFLAKRVLKNLRITEYKITGLSDLPCNQTVYEYFNNRHIKLEYFPCINVGKP-KR-AYIPLELCTLVSLQRYTKAQRASLVEKSRQKPQERAM-RRN-NYADQML-RSFGISIGTQFTQVEGRTLPAPKLKGRWN--FNNKQLVEPMQIKWWAIVNFSARNNLIRGMHINERMFEIIQ-LLLCILPERKNSWKRKNLSEAGIVTQCIAND-QYITNVLLKINAKLGGMNSLLTLEHSRS-IPLVSKPVTMILGMDVSHGPGRS-D-L--PSIAAVVSSRQWPSISRYRASVRTQ-SPKVEMIANLFKELFVDFKRKPENIIIF-RLNTLSCTFLQ---------IEAS-KFLDEKWSPKFTVIVAQKNHHTKFFTVVDKGVCHPRNNDFYLCAHAGMGTSRPTHYHVLHDEIGFSADDLQELVHSLSYVYQRSTTAVSVVTPICYAHLAAAQSQFIKSDTSS-S-ELP-VLHERV--CNSMFF- Citrus_sinensis_CsnAGOlike R-PGFGTGRKC-VVRANHFMVQLIISQLINLYRLTDLGERAYDGMKSIYTA-GPL-PVVIR-LA-S-KPDLPYEVIQVLA-VVLRAAPSEGRSFFST-DLGQLGDGVRGYFQSLRPTQGLSLNIVS-ASSFYEILVTEFVVKKALKGIKVNSHKITGISSQPMSQSVIQYFERYNIALQFLPALVAGSE-AR-PYLPMELSRIVAGQRYAKRQVIALLRATCQRPRERMA-RAN-AYEDTLVNKEFGIQVADDLTSVDARILPAPMLKGQWN--MINKKMFNGGRVEVWTCVNFSTRQGLVDGMVFNEKALVDVQ-LLIIILPDVSGSIKRVCETELGIVSQCCQNM-QYFENVALKINVKVGGRNTVLVDAVQKR-IPLVTDRPTIIFGADVTHPPGED-S-S--PSIAAVVASMDWPEVAKYRGLVSAQ-AHHEEIIQDLYKELLIAFNFKPHRIIFY-RDGVGERQFSQVLLHEMNAIRQAC-ASLEEGYAPPVTFVVVQKRCRTRLFTVVDTEICHPTEFDFYLNSHAAIGTSRPTRYHVLYDENRFTADGLQVLTNNLCYTYARCTRSVSVVPPAYYAYLAAFRRYYIEAGGST-D-PLP-VIKDNV--KDVMFY- Cucumis_sativus_CstAGO1a R-PGKGSGTRC-IVKANHFFAELVMEQLVKLYRVSHLGDRAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPTSARSFYSP-DLGTLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELHVIEFVIKKALRGVKVRKYRISGLTSQATRESVVEYFETYGFVIQHWPCLQVGNQ-QR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPKDRTV-HHN-AYNDPYA-KEFGIKISEKLASVEARILPAPWLKGQWN--MMNKKMFNGGTVNNWMCINFSRYYELAQGMAFNEKALKTRD-LLIVVLPDNNGSLKRICETDLGLVSQCCLSK-QYLANVALKINVKVGGRNTVLVDALSRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEVTKYAGLVSAQ-AHRQELIQDLFKELLISFGQKPQRIIFY-RDGVSEGQFYQVLLHELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFTADGLQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSI-S-PLP-ALKENV--KRVMFY- Cucumis_sativus_CstAGO1b R-PNFGQGTKC-LVKANHFLAIIILTELVKQYRTTELGMRVYDGGSNLYTA-GLL-PVQIK-FV-T-LASMPQEALTIID-IVLRELHAQGRSFYSP-CIKHVGGGLRGFYQSIRPTQGLSLNIMS-STAFIEIPVIDFVVKKVLRGVKVRKYRISGLTSQPTRESVVEYFEMYGYTIQYLPCLQVGNQ-KK-VYLPMEACKILKGQRYTKGQITSLLKVSCQRPSDQTV-HEN-AYADPYA-KEFRISIDNKLTSVEARVLPSPWLKGQWN--MMNKKVIDGSVIRYWACINFSRNQQLVQGMEFNKKALKFVD-LLIAILPDNNGSLKRICETELGLISQCCLSR-QYLANVSLKINVKMGGRNTVLLDALRAR-IPLVSDIPTIIFGADVTHPSGED-S-L--PSIAAVVASQDWPEVTKYAGLVCAQ-PHREELIQDLFKELLLSFGQKPLRIIFY-RDGVSEGQFYQVLLHELDAIRKAC-ASLEPSYQPPVTFIIVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFSADEIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAYRRFYVEENAKR---PLP-ALKERV--KNVMFY- Cucumis_sativus_CstAGO4 R-RGLASGQKI-SLLTNHFKVNVVIDKVHETY-NSELAGKAYDGEKSLFTV-GPL-PVEIS-FA-A-KIPMFQEAIRVLD-IILRQNASKRQSFFHN-DPNDVGGGVRGFHSSFRTTQGLSLNIVS-TTMIIQGPVVDFLAKRTLKNLRIAEYKITGLSEKPCKETVYDYFKHRNIELRYLPCINVGKP-KR-PFIPVELCSLVSLQRYTKAQRASLVEKSRQKPQERSL-RRN-KYAEPML-RSCGIAINSSFIQVEGRVLPAPKLKGRWN--FNNKKLAQPTKIERWAVVNFSARRDLIKGIAIEEKMFEEVQ-FLLCLLPERKNSWKKKNLAEFGIVTQCIAND-QYLTNVLLKINAKLGGLNSLLAVEHSPS-IPMVSKVPTIILGMDVSHGPGQS-D-I--PSIAAVVSSRQWPLISRYRAAVRTQ-SPKVEMIDSLYKELLLDFKRKPDQIIIF-RDGVSESQFNQVLNVELDQIIQSC-KFLDENWNPKFVVIVAQKNHHTKFFTIIDNKICHPRNNDFYLCAHAGMGTTRPTHYHVLLDEVGFSADDLQELVHSLSYVYQRSTTAISVVAPVCYAHLAATQGQFIKSETAS-S-QLP-RLQEKV--CNSMFF- Eucalyptus_grandis_EgAGO1 R-PGKGSGTRC-IVKANHFFAELVMKKLVDTYRESHLGKRAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPTTGRSFYSP-DLGPLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVIKKALRGVKVRKYRISGLTSQATRESVVEYFETYGFAIQHWPCLQVGNQ-NR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPHERTV-RHN-AYEDPYA-KEFGIKISERLAQVEARILPAPWLKGCWN--MMNKKMVNGGTVNNWFCINFSRNHELAHGMAFNERILKARD-LLIVILPDNNGSLKRICETDLGLVSQCCLSK-QYLANVALKINVKVGGRNTVLVDALSRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKELLISFGQKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-NSLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFTADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSV-T-PLP-ALKENV--KRVMFY- Eucalyptus_grandis_EgAGO10a R-PGYGQGTRC-IVKANHFFAVLIMAELLRLYRESDLGMRAYDGRKSLYTA-GEL-PVVIK-FV-A-RANMPQEALQVLD-IVLRELSTKGRSFFSP-NLRQLGDGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIEFVIKKALRGVKVRKYRVSGLTSQPTRESVVEYFEMYGFTILHLPCLQVGNQ-KK-AYLPMEACKIVEGQRYTKRQITALLKVTCQRPRDRTV-QQN-AYQDPYA-KEFGIKISEKLASVEARILPAPWLKGQWN--MMNKKMINGMTVNRWACINFSRSSELAQGMEFNEKALKHVE-LLLAILPDNNGSLKRICETDLGIISQCCLTK-QYLANVSLKINVKMGGRNTVLLDAISCR-IPLVSDIPTIIFGADVTHPNGED-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKDLLVSFGQKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFIVVQKRHHTRLFTVVDTKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRRFYMEENGSM-G-PLP-ALKENV--KRVMFY- Eucalyptus_grandis_EgAGO10b R-PGKGTGEKC-IIKANHFFAQLIMKKLENLYNKSHLGGRVYDGRKSLYTA-GPL-PVIIK-LA-A-RADLPQEVLQVLD-IVLRESPSTGRSFFSP-KLGSLGEGLRGFYQSIRPTQGLSLNIMS-TTAFIELPVVEFVIKKALRGVKIRKYRISNLTSQTTRESVIRYFETYGFNIQLWPCLQVGNP-TK-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPKERTV-DCN-RYEDRYA-EEFGIKISRSLARVEARVLPAPRLKGCWN--MMHKRMVNGGCVNHWLCISFSRASELVEGMVFNEKVLRSRD-LLIVILPDNNGPIKRICETDLGLVSQCCLTK-QYLANVALKINVKVGGRNTVLVDAIYRS-LPVVSDQPTIVFGADVTHPPGED-S-S--PSIAAVVASQDWPEITKYAGLVCAQ-AHREELIQDLYKELLVSFGHKPQRIIFY-RDGVSEGQFYQVLLHELDAIRKAC-NNLEPNYQPPVTFVVVQKRHHTRLFTVVDSQICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENGFSADGLQSLTNKLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMDDSGST-T-PLP-AIKENV--KRVMFY- Eucalyptus_grandis_EgAGO4a R-RGPGSGQKI-PLLTNHFKVNVVIDKVQATY-SSELAGKAYDGEKSLFTV-GPL-PVEIS-FA-A-KIPMSQEALRVLD-IVLRQHASKRQSFFHN-DPRDVGGGVRGFHSSFRTSQGLSLNIVS-TTMIIQGPVVDFLAKRTLKNLRIMEYKITGLSERPCKETVYDYFSHRHIELRYFPCINVGKP-KR-PFIPLELCTLVSLQRYTKAQRASLVEKSRQKPQERAL-NLN-RYAEPML-RSCGVSINTKFTQVEGRVLPAPRLKGRWN--FNNKKLVEPTKIERWAVVNFSARRDLIKGIHIDEKMFEEIQ-FLLCLLPERKNSWKKKNLAEFGIVTQCIAND-QYLTNVLLKINAKLGGLNSVLAVEHSPS-IPLVSKLPTIILGMDVSHGPGQS-D-I--PSIAAVVSSRQWPLISRYRASVRTQ-SPKVEMIDNLFKELLLDFKRKPEQIIIF-RDGVSESQFNQVLNIELDQIIEAC-KFLDEKWSPKFVVIVAQKNHHTKFFTIIDNKVCHPRNNDFYLCAHAGMGTTRPTHYHVLMDEVGFSADDLQELVHSLSYVYQRSTTAISVVAPVCYAHLAATQGQFMKSE----S-QLP-RLQEKVCNSNSMFF- Eucalyptus_grandis_EgAGO4b R-RGLGSGQKI-ALLTNHFKVNVVMDRVQETY-SSELSGKAYDGEKSLFTI-GPL-PVEIS-FA-A-KIPMFQEAVRVLD-IILRQHAAKRQSFFHG-DPRDVGGGVRGFHSSFRTTQGLSLNIVS-TTMIIQGPVIDFLAKRTLKNLRIAEYKITGLSESPCKDTVYDYFNHRKIDLRYFPCINVGKP-KR-PYIPLELCSLVSLQRYTKSQRASLVEKSRQKPQERAL-KRS-NYSEPML-RSCGITISNSFTQVEGRVLPAPKLKGRWS--FQNKKFVEPAKMQKWAVVNFSARRDLTRGLITEDKMFEEIL-FLLCLIPERKNCWKKKNLSDYGIITQCLCND-QYLTNVLLKINAKLGGLNSLLTVERSPS-IPVVSKVPTMILGMDVSHGPGHS-D-I--PSIAAVVSSRQWPLISRYRATVRTQ-SPKVEMIDSLFKELLLDFKRKPDQIIIF-RDGVSESQFMQVLNIELDQIIEAC-KFLDEKWSPKFVVIVAQKNHHTKFFTVIDNKVCHPRNNDFYLCAHAGMGTTRPTHYHVLYDEVGYSADELQELVHALSYVYQRSTTAISVVAPICYAHLAATQAHFVKSETSS-S-QMP-KLQENV--SSSMFF- Eucalyptus_grandis_EgAGO4c R-RGLGSGQKI-ALLTNHFKVNVVMDRVQETY-SSELSGKAYDGEKSLFTI-GPL-PVEIS-FA-A-KIPMFQEAVRVLD-IILRQHAAKRQSFFHG-DPRDVGGGVRGFHSSFRTTQGLSLNIVS-TTMIIQGPVIDFLAKRTLKNLRIAEYKITGLSESPCKDTVYDYFNHRKIDLRYFPCINVGKP-KR-PYIPLELCSLVSLQRYTKSQRASLVEKSRQKPQERAL-KRS-NYSEPML-RSCGITISNSFTQVEGRVLPAPKLKGRWS--FQNKKFVEPAKMQKWAVVNFSARRDLTRGLITEDKMFEEIL-FLLCLIPERKNCWKKKNLSDYGIITQCLCND-QYLTNVLLKINAKLGGLNSLLTVERSPS-IPVVSKVPTMILGMDVSHGPGHS-D-I--PSIAAVVSSRQWPLISRYRATVRTQ-SPKVEMIDSLFKELLLDFKRKPDQIIIF-RDGVSESQFMQVLNIELDQIIEAC-KFLDEKWSPKFVVIVAQKNHHTKFFTVIDNKVCHPRNNDFYLCAHAGMGTTRPTHYHVLYDEVGYSADELQELVHALSYVYQRSTTAISVVAPICYAHLAATQAHFVKSETSS-S-QMP-KLQENV--SSSMFF- Eucalyptus_grandis_EgAGO7 R-PDSGGGPVI-SLLANHFLVQVIKRQLVKEN-SAMFSGAAFDGRKNLFSP-VEF-QINMK-LV-S-KLDGPQDYLHALD-VVLRESPAEGRSMYSS-STGEIGGGARGFFQSLRPTQGLSLNVFS-VTAFHEIGVIPYLVEKALKNIRIQRYRVYGLTEAPTENKLVSYFNQYNYEIEFLPCLQTSR--SK-PYLPMELCVICEGQKFLGKQTARILKMGCQRPKERVM-RGPVGPSGNQE-REFNLQISREMTRVNGRILQPPKLKRQWN--LMDSHVFEGIRIEKWALISFGGTSQLSQGIYLSESKLKEIR-LLLCIMEKKHKGLKRIAETTIGVVSQCCLNS-QFLANLALKINAKVGGCTVALYNSLPSQ-IPRIQNEPVIFMGADVTHPPLDD-F-S--PSVAAVVGSMNWPAANKYASRMRSQ-THRQEIIQDL--ELLDDFKELPRRIIFF-RDGVSETQFHKVLKEELLAIKKGC-ARFP-GYRPTVTFVVVQKRHHTRLFTVVDTVITHPKEFDFYLCSHSGVGTSRPAHYHVLVDENEFTSDELQKLVYNLCYTFVRCTKPVSLVPPAYYAHLAAYRRLYLESAHTR-N-PLP-KLSENV--KKLMFY- Glycine_max_GmAGO10like R-PGYGQGTKC-IVKANHFFAELIIAELVRLYKESDLGMRAYDGRKSLYTA-GQL-PVVIK-FV-A-RANLPQEALQILD-IVLRELSTKGRSFFSP-DIRRLGEGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVVEFVIKKALRGVKVRKYRVSGLTSQPTRESVVEYFEMYGFTIQYLPCLQVGNQ-KK-AYLPMEACKIVEGQRYTKRQITALLKVTCQRPRDRTV-QHN-AYQDPYA-KEFGIKISEKLASVEARILPAPWLKGQWN--MMNKKMINGMTVSRWACINFSRSNELAQGMEFNEKALKHVE-LLLAILPDNNGSLKRICETDLGLISQCCLTK-QYLANVSLKINVKMGGRNTVLLDAVSSR-IPLVSDMPTIIFGADVTHPNGEE-L-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKDLLVSFGQKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFIVVQKRHHTRLFTVVDTKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTPDGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRRFYMEDNGSA-G-PLP-DLKENV--KRVMFY- Glycine_max_GmAGO16like R-NGVGTGKHI-PLLVNLFEVAVVIDRLYQTY-SSELGGKVYDGGKTLYTV-GPL-PVEIS-FA-T-KIPLSQDALRVLD-TILRQRAANRQSFFHD-DSRDVGAGVSGFHSSFRSTQGLSLNIVS-TTIIIKGPVIDFLAKKMLKNLRVQEFKISGLSEKPCIQTVYEYFKHCGIELTSLPCLDVGKP-KR-PYLPLELCSLVSLQRYTKVQRASLVEKSRQKPQDRAV-GKC--YDDPVL-AACGISIEKQLNLIEGRVLETPKLKGRWN--FNKKTLLQASHIDYWAVVNFSASRELIRGINIEERMFDLLK-LILCVLPERKICWKKKCLSEIGVVTQCIATN-QYLTNVLLKINSKLGGINSLLAIEHSGH-LPLIKDTPTMILGMDVSHNLGRL-D-S--PSIAAVVGSRHWPLISRYRASVRMQ-ASKVEMIDALYKELLLDFGRKPTQFIVF-RDGVSESQFEQVLTIELNQIIKAY-QHLGEVNVPQFTVIVAQKKHHIKLFTVVDTTITHPRNYDFYMCAHAGMGTSRPVHYHVLLDEIGFSADGLQNLIHSLSYVNQRSTIATSVVAPICYAHHAAAQGQLLNSETGS-S-ELP-RLHRNV--RSSMFF- Glycine_max_GmAGO2like1 R-PDNGGILTS-RLRVNHFPVKFIREKLFSDD-PERLPLEAHDGAKNIYSA-VQL-PVTLT-LV-N-KLRLPRDILQGMD-VVVKENPARGRHFYPT-NPPDLHHGIGGFQHSLKPTSGLSLCVYS-VLAFRKMSVLDFLIEEALIGLKVRKYIISRLTPMITRYSLITFFEKYGKDIVYIPCLDLGKD-RK-KYVPMEFCVLVEGQRYPKESANTLKAMSLAHPNERMV-QSSDGP-SDLI-QNFGISVNTTMTTIVGRVLGPPELKCHWN--LAGKSMVEGKPVEYWGVLDFTSCQKLIGGIYMQSELLEKIQ-FLLCVMAKKSPGLKWISETKLGILTQCCLED-KFYTNLALKINAKLGGSNVELSN----G-LPYFDEGDVMFLGADVNHPYQDT-R-S--PSIAAVVATVNWPAANRYAARVFPQ-YNRSEKILNF--ELVACYGVRPERIVIF-RDGVSEYQFDMVLNEELLDLKGVF-QRV--NYFPTITLIVTQKRHHTRFFTVVDTKVIHPYEFDFYLCSYYGNGTSKPTHYHVLWDEHKFTSDLLQKLIYEMCFTFAKCTKPVSLVPPVYYADLAAYRRLYHEMQSPK-S-GFY-TLHADL--ENIMFF- Glycine_max_GmAGO2like2 R-PDNGGVRKC-YLRVNHFPVSFIRDKLFSDN-----SLPAYDGEKNIFSA-VPL-PVSLT-LV-S-RLELPRDVLHGLD-LVVKENPSKGRCFFPM-NPPDLNHGIGGFQQSLKSTSGLSLCLYS-VLSFRKLLVLDFLVEHVLIGLKVQKYTITRLTPKVTRHTLVGYFEKYGVNIEYIPALDFGG--NK-TFVPMELCELVEGQRYPKEAAKDLKDMSVAPPRVRMV-NSEDGPGGGVI-KNFGMSVNTSMTNVTGRVIQPPQLKCQWN--LVGRSMVEGKPVECWGILDFTSQENLMGGIGMKCKLLENIQ-FLLCVMSDKHQGLKWIAETKVGIVTQCCLKD-QYLTNLALKINAKIGGSNVELIN----R-LPHFGEGHVMFIGADVNHPSRDI-N-S--PSIAAVVATVNWPAANRYAARVCAQ-GHRVEKILNF--ELVSYYKVRPEKIVVF-RDGVSESQFHMVLTEELQDLKSVF-SDA--NYFPTITIIVAQKRHQTRFFTVVDTKVVHPFEFDFYLCSHYGSGTSKPTHYHVLWDEHKFNSDDLQKLIYDMCFTFARCTKPVSLVPPVYYADLTAYRRLYYEMQSPG-S-GYY-KLHADV--ENIMFF- Glycine_max_GmAGO4Blike R-KEVGSGEPR-QLLANHFGVCLVLNQVCETY--VELRNMAYDGEKSLFTL-GPL-AVDIK-YA-A-KIPLSQEAVRVLD-IILRQHSANRQSFFHD-NRRDIGGGVRGFHSSFRVTQGLSLNMVT-TTMIVKGPVVDFLAKRMLKNLRIVEFKISGLSDNTCRNTVHDYFRQKLIGLNYMPCINVGKP-KR-PYFPIELCEMVSLQRYTKAQRAQLVEKTRQKPQVRAL-RSS-RYDEPML-RSSGITIEPNFVRLVGRVLEPPKLIGRWN--FNNKKLYEPLMIGRWAIVNFSSRELIRRGMTMSERMYAKLH-FLLCILPEKKNSWKKKSLVEEGIVTQCIAND-QYITNVLLKINAKYGGMNSYLSVELCNS-IPFVSAVPTLILGMDVSHGPGRS-D-V--PSIAAVVSSRCWPQISRYRASVRTQ-SSKVEMIQSLFKEVLLDFKRKPQQIIIF-RDGVSESQFNQVLNIELSQIIEAC-KHLDEKWDPKFTLIIAQKNHHTRFFTVIDNTVCHPKNNDFYLCAQAGMGTTRPTHYHVLHDEIGFSADEVQELVHSLSYTYQRSTTAVSLVAPICYAHLAAAQAQFMKSETSS-T-QLP-RLHKQV--INSMFF- Glycine_max_GmAGO4like R-RGLASGTKL-QLLTNHYRVNVLLDRVHETY-DSELNGKAYDGEKTLFTL-GSL-AVELS-YA-S-KIPLYQEAIRVLD-IILRQHAAKRQSFFHN-DPKDVGGGVRGFHSSFRTTQGLSLNIVS-TTMIITGPVVDFLAKRTLKNLRIQEFKITGISEFPCKDTVYDYFNIRKIDLRYLPCINVGKP-KR-PYIPLELCSLVSLQRYTKAQRASLVEKSRQKPQERAL-KSS-NYSEPML-RNCGISISPNFTEVEGRVLQAPRLKGRWN--FNNKKIVKPTKIERWAVVNFSARRDLIKGIVIDEKMFELVQ-FLLCLLPERKNSWKKKNLAEFGIVTQCIAND-QYLTNVLLKINAKLGGLNSILGVEHSPS-IPIVSRAPTIIIGMDVSHGPGQT-D-I--PSIAAVVSSREWPLISKYRASVRTQ-SPKMEMIDNLFKELLLDFNRKPDNIIIF-RDGVSESQFNQVLNIELDQIIEAC-KFLDEKWNPKFLVIVAQKNHHTKFFTVIDNKICHPRNYDFYMCAHAGMGTSRPTHYHVLLDEIGFSPDDLQELVHSLSYVYQRSTTAISVVAPICYAHLAATQGQFMKSETSS-S-QLP-RLQENV--SSSMFF- Glycine_max_GmAGO5like2 R-PGFGLGEKI-KVRANHFQVQVVMTLLVQAHREKILGNRAYDGGKSLFTA-GSL-PVTIR-LA-S-RTDIPYETIQALD-VVLRATPSEGRSFFSP-SLGSLGSGTRGYYQSLRPTQGLSLNIVS-ARAFYEIPVIDFILKRVLRGVKVRRYKITGVTKEQLRKSVVQYFEKYNIVLKHLPALQAGSD-IK-PFLPMELCQIVAGQRYTKRQVTNLLRASCQRPRDRVV-RQS-NFTDKFV-SHFGIQVREDPALLDARVLPAPMLKGQWN--MIDKKMFNAGVVEHWTCLNFSGKHKLARGMRFNESALVNLQ-LLIIILPDFEGSIKRICETELGIVSQCCQKP-QYLENVALKINVKVGGSNTVLNDAIARI-IPRVSDRPTLILGADVTHPPGED-S-S--PSIAAVVASMDWPYVTRYRGVVSAQ-THREEIIQDLYNELLRAFNQKPERIIFY-RDGVSEGQFSQVLLYEMDAIRRAC-ASLQEGYLPRVTFVVVQKRHHTRLFTVVDTHICHPREFDFYLNSHAGMGTSRPTHYHVLFDENNFTADGLQMFTNNLCYTYARCTRSVSIVPPVYYAHLAAFRRCYIEDSGSA-S--LP-SVKENV--KDVMFF- Glycine_max_GmAGO7like R-PDSGGGSVI-SLLANHFLVQFIKQKLVNNN-SAVLSGAAYDGRKNLYSP-VEF-QINVK-LV-S-KINGPQDYLHALD-VVLRESPTEGRSFYSS-SMGDIGGGARGFFQSLRPTQGLALNVFS-VTAFHEIGVIAYLVEKALKSIRVQRYRVYGLTEEVTENRLVNYFDQYNYDIQFLPCLQISR--SK-PYLPMELCVICEGQKFLGKQTARILKMGCQRPAERVM-RGTVGPSGDQE-KEFKLQVSREMTKLTGRILHPPKLKRQWN--LLDGHVFEGTTIERWALISFGGTNQLCQGIFLNESKLKRIQ-LLICIMERKHKGLKRIAETSVGVMSQCCLSS-QFLANLVLKINAKVGGCTVALYNSLPSQ-LPRLIDEPVIFMGADVTHPPLDD-V-S--PSVAAVVGSMNWPTANKYISRIRSQ-THRQEIIQDL--ELLDDFEKLPNRIIFF-RDGVSETQFYKVLEEELQSIRFAC-SRFP-GYKPTITFAVVQKRHHTRLFTVVDSVITHPKEFDFYLCSHWGVGTSRPTHYHVLWDENQFTSDELQKLVYNLCYTFVRCTKPISLVPPAYYAHLAAYRRLYLELGLFR-S-ALP-KLSENI--KKLMFY- Glycine_max_GmAGOlike1 R-PGKGSGTKC-VVKANHFFAELVMEQLVRLYRESHLGKRAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPTTGRSFYSP-DLGPLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVIKKALRGIKVRKYRISGLTSQATRESVVEYFETYGFVIQHWPCLQVGNT-QR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPVERTV-HHN-AYEDPYA-KEFGIKISEKLAQVEARILPAPWLKGQWN--MMNKKMVNGGTVNNWFCINFSRNYELAQGMAFTEKVLKTRD-LLIVILPDNNGSLKRICETDLGLVSQCCLSK-QYLANVALKINVKVGGRNTVLVDALSRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDYPEITKYAGLVCAQ-AHRQELIQDLFKELLISFGQKPQRIIFY-RDGVSEGQFYQVLLFELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADALQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSM-T-PLP-ALKENV--KRVMFY- Glycine_max_GmAGOlike2 R-SGLGSGNKI-QLLTNHFKVNVIIDRVQETY-HSDLNGKAYDGEKSLFTV-GSL-PVEIS-FA-A-KIPMFQEAIRVLD-IILRQHAAKRQSFFHN-NPNDVGGGVRGFHSSFRTTQGLSLNIVS-TTMIISGPVVDFLAKRTLKNLRIQEFKISGLSELPCRETVYDYFKVRKIDLRYLPCINVGKP-KR-PFFPIEVCELVSLQRYTKAQRASLVEKSRQKPQERAL-RTS-NYAEPML-RNCGISISTGFTEVEGRVLPAPRLKGRWN--VSRVKFVEPSKIERWAVANFSARRDLIRGITIEEKMFEHIQ-FLLCLLPDRKNCWKKKNLADFGIINQCMCND-QYLTNVMLKINAKLGGLNSLLGVEHSPS-LPVVSKAPTLILGMDVSHGPGQT-D-I--PSIAAVVSSRHWPLISKYRACVRTQ-SAKMEMIDNLFKELLLDFRRKPENIIIF-RDGVSESQFNQVLNIELDRIIEAC-KFLDENWEPKFVVIVAQKNHHTRFFTVIDNKICHPRNYDFYLCAHAGMGTSRPTHYHVLLDQVGFSPDQLQELVHSLSYVYQRSTTAISVVAPICYAHLAATQGQFMKSETSS-S-QLP-PLQENV--RNTMFF- Glycine_max_GmPNH1like1 R-PGFGQGTKC-VIKANHFLADIIIAELVRLHRNTDLATRVYDGGRNLYTA-GLL-PVVIK-FA-T-RVSMPQEALSVFD-IVLRELAAQGRFLYSP-DVRQLGGGLRGFYQSIRPTQGLSLNIMS-SMAFIELPVIDFVIKKALRGVKVRKYRISGLTSQPTRESVVDYFETYGFTIKYLPCLQVGSQ-RK-VYLPMEACKIVGGQRYTKGQITSLLKISCQRPREQTI-QQN-NYNNPYA-KEFGISIENKLASVEARVLPAPWLKGQWN--MMNKKVINGSTVRYWACINFSRSQQLVQGMEFSKKALKYVE-LLIAILPDNNGSLKRICETDLGLISQCCLNR-QYLANVALKINVKMGGRNTVLLDALSWR-IPLVSDIPTIIFGADVTHPSGED-S-C--PSIAAVVASQDWPEVTKYAGLVCAQ-PHREELIQDLFRELLLSFGQKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPSYQPPVTFVVVQKRHHTRLFTVVDSKICHPSEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADEIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAYRRFYMEEITKL---PLP-ALKEKV--KNVMFY- Glycine_max_GmPNH1like2 R-PGYGQGTKC-LVKANHFLADIIIAELVRLHRNTDLAMKVYDGGRNLYTA-GLL-SVVIR-FA-A-RVSMPQEALTVID-TVLRELAAQGRFLYSP-DLRQLGGGLCGFYQSIRPTQGLSLNIMS-SMAFIELPVIDFVIKKALRGVKVRKYRITGLTSQPTRESVVDYFEMYGYTIIYLPCLQVGSQ-KK-VYLPMEACKIVGGQRYTKGQITSLLKVSCQRPREQTI-HQN-DYYNPYA-KEFGISIDSKLASVEARVLPAPWLKGQWN--MMNKKVINGSTVRYWACINFSRSQQLVQGMEFSKKALKYVE-LLIAILPDNNGSLKRICETDLGLISQCCLNR-QYLANVALKINVKMGGRNTVLLDALSWR-IPLVSDIPTIIFGADVTHPSGED-P-C--PSIAAVVASQDWPEVTKYAGLVCAQ-PHREELIQDLFKELLLSFGQKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPSYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADEIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAYRRFYMEEIAKS---PLP-ALKEKV--KNVMFY- Homo_sapiens_HsAGO2 R-PDFGTGRTI-KLQANFFEMDIIVEHMVQHFKTQIFGDRVFDGRKNLYTA-MPL-PVSIK-WV-S-CVSLPFETIQALD-VVMRHLPSMGRSFFTA-SEGPLGGGRFGFHQSVRPSLKMMLNIVS-ATAFYKQPVIEFVFTKEIKGLKVRKYRVCNVTRRPASHTVAQYFDRHKLVLRYLPCLQVGQE-QK-HYLPLEVCNIVAGQRCIKKQTSTMIRATARSAPDRLM-RSA-DFTDPYV-REFGIMVKDEMTDVTGRVLQPPSILGVWD--MRNKQFHTGIEIKVWAIACFAPQEQLRKGMPIQEPMFRHLQ-LVVVILPGKTPVVKRVGDTVLGMATQCVQTP-QTLSNLCLKINVKLGGVNNILLPQG----RPPVFQQPVIFLGADVTHPAGDG-K-K--PSIAAVVGSMD-AHPNRYCATVRVQ-QHRQEIIQDL--ELLIQFRFKPTRIIFY-RDGVSEGQFQQVLHHELLAIREAC-IKLEKDYQPGITFIVVQKRHHTRLFTTVDTKITHPTEFDFYLCSHAGIGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRRYHLVDSAEG-S-KAV-QVHQDT--LRTMYF- Hordeum_vulgare_HvAGO10 R-PGMGKGDRC-VVKANHFFAELVIAELVKLYRQSHMNGRAYDGRKSLYTA-GPL-PVVIK-YA-A-RADLPQEALQVLD-IVLRELPTASRSFYSP-NLGRLGDGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIEFVIKKALRGVKVRKYRISGLTSQATRETVVQYFETYGFNIQHLPCLQVGNQ-QR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPQERTV-HHN-AYEDPYA-QEFGIKIDEQLASVEARVLPPPRLKGQWN--MMNKKMVNGGRVSHWACINFSRNHELAIGMNFAERALKARD-LLIVILPDNNGSLKRICETELGLVSQCCLSK-QYLANVALKINVKVGGRNTVLVDALARR-IRLVTDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEITKYAGLVSAQ-AHRQELIQDLFKELLISFGQKPQRIIFY-RDGVSEGQFYQVLLFELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFTADELQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSV-A-PLP-ALKENV--KRVMFY- Hordeum_vulgare_HvAGO1a ------------------------------------LDGRAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTAGRSFYSP-NLGKLGDGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVIKKALRGVKVRKYRISGLTSQATRETVVQYFETYGFNIQHLPCLQVGNQ-QR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPQERTV-HHN-AYEDPYA-QEFGIKIDERLASVEARVLPPPRLKGQWN--MMNKKMVNGGRVSHWACINFSRNHELAIGMDFAERALKARD-LLIVILPDNNGSLKRICETDLGLVSQCCLSK-QYLANVALKINVKVGGRNTVLVDALTRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEVTKYAGLVSAQ-AHRQELIQDLFKELLISFGQKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFTADELQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSM-A-PLP-ALKENV--KRVMFY- Hordeum_vulgare_HvAGO1b -----------------------VINELVNQHRAAYLGGRAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPSAGRSFFSP-DLGPLGDGLRGFYQSIRPTQGLSLNIMS-ATAFIELPVIDYAIKKALRGVKVRKYRISGLTTQATRESVVQYFETYGFAIQHLPCLQVGNQ-QR-PYLPMEVCKIVEGQRYSKRQIRALLDETCQYPRDRMV-KHN-AYEDPYA-KEFGIKISDRLASVDARILPAPRLKGQWN--MMNKKMVNGGKVRSWMCVNFARNHQLAQGMDFAERALKARD-LLIGILPDNNGSLKRVCEIDLGIVSQCCCNK-QIYANIALKINVKVGGRNTVLVDALSRR-IPLVTDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEVTRYAGLVSAQ-AHRQELIEDLYKELLISFGEKPQRIIFY-RDGVSEGQFYQVLLFELNAIRKAC-ASLEANYQPKVTFVVVQKRHHTRLFTVVDTKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADGLQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSM-A-PLP-AMKDSV--KNVMFY- Hordeum_vulgare_HvAGO3 R-PDDGGQARV-QLLVNHFIVKYAKAELFKDD-SFRQLSSAYDGKRNLFTA-AQL-PVSVE-FK-K-QLPLAREILQGLD-VIVREASTWGHGFYSP-DS-DMGSGVKGTQQTLKHTQGLVLCVYS-VMPFRKGPVLDIVLVYELKGQRIQKYTIQGFTDLPASQRLVDYFQQYGKVIEYLPCLDLSKSRDK-PYVPIELCKLVEGQRYPMATERALKGKALIKAAERAV-KAEDGPRGEIA-QQFGISLDVKMMEVTGRVLTPPSLTCQWN--LMGKKLVEGKALQCWGIVDFSARNYIVRGIQMNHEELNKAQ-LLFCPMSEQHHGLKLICETQLGIQTQCFLQD-QYMSNLALKINGKLGGINTQLQD----K-LPLDNGVPYMFIGADVNHPPGNG-E-S--PSIAAVVASMN-RGATKYVPRIRAQ-PHRCEVIKNL--ELIGVFGVKPQRIIYF-RDGVSDGQFEMVLNEELADMENVI-KV---GYSPTITVIVAKKRHHTRLFTVVDTRIVDPVTYDFYLCSHNGLGTSRPTHYYNLMDEHGYGSDDLQRLVYNLCFVFARCTKPVSLATPVYYADLAAYRRLYYESQPQV-R-NFP-TLHVDL--QDNMFF- Hordeum_vulgare_HvAGO5 R-PGAGTGKKV-MIRANHFLVNVVLSELIKVHGKTSLGGKAYDGRKSLYTA-GSL-PITIR-IA-G-RTDLPQETIQVLD-VVLRESPSWSRSFFST-TFGDIGEGLRGYYQSLRPTQGLSLNIIS-ATSFFKVTVVQFVIKKALRGVRVRRYKITGITPIPMSQSVVQYFQRYDYNLKYWPCLQSGSD-AR-PYLPMEACKIVEGQRYSKKQVTNILRATCQRPQQRMV-LHN-KYEDKFA-QEFGIKVCSDLVAVPARVLPPPMLRGQWN--MINKKMINGGIIDNWACVSFS-RCDLIQGMSVNENALRDVQ-LLIVILPEVSGSIKKVCETDLGIVSQCCLNK-QYLENVALKINVKVGGRNTVLERAFVRNGIPFVSEVPTIIFGADVTHPPGED-S-A--SSIAAVVASMDWPEITKYRGLVSAQ-PHRQEIIEDLFSELLIAFGRRPERILFY-RDGVSEGQFSHVLLHEMDAIRKAC-ASLEEGYMPPVTFVVVQKRHHTRLFTVVDLMICHPTEFDFYLCSHAGIGTSRPTHYHVLYDENHFTADALQSLTNNLCYTYARCTRAVSVVPPAYYAHLAAFRRYYVEDGGST-P-QLP-KIKENV--KDVMFY- Kluyveromyces_polysporus_YeastAGO R-HDYGTGTKV-DILTNHILLAVLIEALLDEDEILYKYRDAFNGEDTIYSH-VPL--ITLK-FS-G-KVGLQESRMSAIDKTCLLSLLGAGNKFFIFNNFAPFQIGGQGFTVSLTHVYGVALNTVSVPAPFIKFTLMDWIISALLKGLKVSSKGIVGFTRESAVSNTIDYFRKYDITLKYMKLVNLGGK----NVVPPECLTIVPGQKLKGQ-TKTYIDFSAIRPTEKAI-KRG-LTSEKEE-SSAPHNSAYQFMRVPSRILDAPVVQGNWN--MKGHQFISTPAKQVNLRAIFINNDKFASGVDFNEISLLNLT-YILYVLRRGNDSLKYITDLKFGALNSCVVSI-QYNSNVVMKMNLKLLGSNHSLSIENNKLLIDKESNLPILVLGSDVTHYEKDQ------NSIASLVGSYD-DKFTQFPGDYMLQDGPGEEIITNV--NRLKIYGKLPTKIMYF-RDGVSVDQFSQVVKIEVKSIKESV-RKFGPKYDPPVTCIATVKRNQVRFITVVDRGITSVAHFDFFIQSHQALGTGVPCHYWCLYDENQSTSDYLQEICNNLCYIFGRSTTSVKVPAPVYYADLLCTRTCFFKAQAPK-E-LLP-QVNDNI--KSVMYY- Linum_usitatissimum_LuAGO1 R-PGKGTGHKC-VVKANHFFAELVINQLVTLYRESHLAKRAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPNSGRSFYSP-NLGPLGDGLRGFYQSIRPTQGLSLNIMS-STAFIELHVIDFVIKRALRGVKVRKYRISGLTSQATRDSVVEYFETYGFSIQHWPCLQVGNQ-QR-PYLPMEVCKIVEGQRYSKKQITNLLKVTCQRPVDRTV-RHN-AYEDPYA-TEFGIKISKNLASVEARILPAPRLKGQWN--MMNKKMVNGGTVNNWICLNFSRQFELAQGMQYNEKVLKTHD-LLIVILPDDNGSLKRICETDLGLVSQCCLNK-QYLANVALKINVKVGGRNTVLVDALSRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEITKYAGLVCAQ-AHRQELIQDLYKELLISFGHKPERIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFSADALQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSM-T-PLP-SLKENV--KRVMFY- Linum_usitatissimum_LuAGO10a R-PGFGQGTKC-VVKANHFFSELIMAELVKRHRESDLGMRAYDGRKSLYTA-GEL-PVALK-FV-A-RANMPQEALKILD-IVLRELSTKGRSFFSP-DIRRLGEGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVVEYVIKKAFRGVKVRKYRVSGLTAQPTRESVVEYFEMYGFTIQHLPCLTVGNQ-KK-AYLPMEACKIVEGQRYSKRQITALLKVTCQRPRDRTV-QQN-AYQDPYA-KEFGLNISEKLASVEARILPAPWLKGQWN--MMNKKMINGMTVNRWACINFSRSSELGQGMEFNEKALKHVE-LLLAILPDNNGSLKRICETDLGIISQCCLSK-QYLANVSLKINVKMGGRNTVLLDAISCK-IPLVSDIPTIIFGADVTHPNGED-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKDLLISFGQKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPLVTFIVVQKRHHTRLFTVVDTKICHPSEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRRFYLEDNGSS-T-PLP-ALKENV--KRVMFY- Linum_usitatissimum_LuAGO10b R-PGKGTGLRC-VVKANHFFAELVINQLVGLYRESHLGKRAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPNSGRSFYSP-DLGPLGDGLRGFYQSIRPTQGLSLNIMS-STAFIELKVIDFVIKKALRGVKVRKYRISGLTSQATRESVVEYFETYGFTIQHWPCLQVGNQ-QR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPQERTV-QHN-AYSDPYA-KEFGIKISERLASVEARILPAPLLKGQWN--MMNKKMVNGGTVNYWLCINFSRQYELAQGMQFNERVLKARD-LLVVILPDNNGSLKRICETDLGLVSQCCLSK-QYLANVSLKINVKVGGRNTVLVDALSRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEITKYAGLVCAQ-AHRQELIQDLYKELLISFGQKPERIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFSADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSM-T-PLP-SLKENV--KKVMFY- Linum_usitatissimum_LuAGO4a R-RGSGSGQKI-TLLTNHFKVNV----------------------------------VQLN-FA-A-KIPMSQEALRVLD-IILRQHAAKRQSFFHN-DPKDLGGGVRGFHSSFRTTQGLSLNIVS-TTMIIQGPVVDFLAKRVLKNLRIQEYKITGLSDQPCKETVYDYFNNRNMDLRYLPCINVGKP-KR-PYIPLELCSLVSLQRYTKAQRSSLVEKSRQKPQERSL-KTS-KYAEPML-RSCGISIGTSFLQVEGRVLPAP--KGRWN--FNNKRLVEPVKVERWAVVNFSARPDLLRGIGMEEKMFEAIK-FLLCILPERKNCWKRKCLSDFGIFTQCLAND-QYLTNLLLKINAKLGGLNSLLAVEHIPS-IPIVSKVPTMILGMDVSHGPGQF-D-V--PSIAAVVSSRKWPLISKYRASVRTQ-SPKVEMIDSLFKEALLDFKRKPEQIIIF-RDGVSESQFNQVLNIELDQIIEAC-KFLDEKWDPKFVVIVAQKNHHTKFFTIIDNKVGHPKNNDFYLCAHAGMGTTRPTHYHVLMDEVGFSTDDLQELVHSLSYVYQRSTTAISVVAPICYAHLAASQGQFIKSETSS-S-QLP-RLEEKV--ANSMFF- Linum_usitatissimum_LuAGO4b R-RGSGSGQKI-TLMTNHFKVNVVLDKVHQTY-TGELGGKAYDGEKSLFTI-GQL-PVQLN-FA-A-KIPMSQEALRVLD-IILRQHAAKRQSFFHN-DPKDLGGGVRGFHSSFRTTQGLSLNIVS-TTMIIQGPVVDFLAKRVLKNLRIQEYKITGLSDQLCKETVYDYFNHRSMDLRYLPCINVGKP-KR-PYIPLELCSLVSLQRYTKAQRSSLVEKSRQKPQER--------------------------------------------------RLVEPAKVERWAVVNFSARPDLLRGIGMEEKMFEAIK-FLLCILPERKNCWKRKCLSDFGIFTQCLAND-QYLTNLLLKINAKLGGLNSLLAVEHIPS-IPIVSKVPTMILGMDVSHGPGQF-D-V--PSIAAAISSRKWPLISKYRASVRTQ-SPKVEMIDSLFKEALLDFKRKPEQIIIF-RDGVSESQFNQVLNIELDQIIEAC-KFLDEKWDPKFVVIVAQKNHHTKFFTIIDNKVGHPKNNDFYLCAHAGMGTTRPTHYHVLMDEVGFSSDDLQELVHSLSYVYQRSTTAISVVAPICYAHLAASQGQFIKSETSS-S-QLP-KLEDKV--ANSMFF- Linum_usitatissimum_LuAGO5 R-PGKGTGHKC-VVKANHFFAELVINQLVTLYRESHLAKRAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPNSGRSFYSP-NLGPLGDGLRGFYQSIRPTQGLSLNIMS-STAFIELHVIDFVIKRALRGVKVRKYRISGLTSQATRDSVVEYFETYGFSIQHWPCLQVGNQ-QR-PYLPMEVCKIVEGQRYSKRQITNLLKVTCQRPVDRTV-KHN-AYEDPYA-TEFGIKISKNLASVEARILPAPRLKGQWN--MMNKKMVNGGTVNNWICINFSRQFELAQGMQYNEKVLKTHD-LLIVILPDKNGSLKRICETDLGLVSQCCLSK-QYLANVALKINVKVGGRNTVLVDALSRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEITKYAGLVCAQ-AHRQELIQDLYNELLISFGHKPERIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFSADALQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSM-S-PLP-SLKENV--KRVMFY- Linum_usitatissimum_LuAGO6 R-KGSGTGQRI-TLLTNHFKVSVLIDKLYQTY-SSEFSGKAYDGEKTLYTV-GPL-PIEIS-YA-A-KIPLIQDALRVLD-IILRQQAASRQSFFHD-DSRDVGQGVRGFHSSFRTTHGLSLNMVS-TTMVLTGPVIDFLARRMLKNLRIREFKIIGLSERPCRQTVYDYYKHCAIELKYFPCLNVGKP-KK-PYLPIELCSLTSLQRYTKAQRASLVEKSRQKPQDRAM-RKY-RYEDPLL-LECGISLEKNLTPVTGRVLKTPKLKGRWN--FNNKTLLNGKSIERWAIVNFSAQRDLIAGMEIEESMFELVQ-FLLCLLPQRKNSWKKKCLSDFGIVTQCISKD-QYLTNVLLKINSKFGGINSMLEIEHSHS-IPLITQTPTMILGMDVSHGPGGS-D-V--PSVAAVVGSIEWPYVTKYRASVRTQ-SPKVEMIDALYDELFREFGHKPKQIIIF-RDGVSESQFNQVLNIELPQIIKAY-HHLGEVDVPKFTVIIAQKNHHTKLFTVVDTTVVHPRNYDFYMCAHNGAGTSRPAHYHVLIDEIGFTPDELQNLIHSLSYVYQRSTTAISIVAPVCYAHLAAAQSQFIKSEKSS---ALP-KLHKNV--EASMFF- Linum_usitatissimum_LuAGO7 R-PDSGGGSMI-TLLANHFLVKFIKQKMVKEN-QSLLSNASYDGRKNLYSP-VQF-QVNIN-LV-S-KLKGPQDYLHALD-VVLRESPSEGRSMYSS-SMGEIGGGARGFFQSLRPTQGLALNVFS-VTAFHEIGVIFYLVEKALKNIRVQRYKVYGLTDEATENRVVDYFDHYGYDIQFLPCLQISR--SK-PYLPMELCMICDGQKFIGKQTAKILNMGCQRPKERVM-QGPVGPSGNQA-KEFKLHVSREMTRLKGRILQPPKLKRQWN--LLDGHVYEGTKIERWGLISFGGSRQLSHGIFLNETKLKNIQ-LLICLMEKKHKGLKRIAETSAGVVTQCCLSS-QFLANIALKINAKVGGCTVALYNSLPSQ-IPRLIDEPVIFMGADVTHPPFDD-S-S--PSVAAVVGSMNWPAANKYVSRMRSQ-THRQEIIHDL--ELLDEFSKLPRRIMFF-RDGVSETQFKKVLKEELQAIKEAC-SKFP-GYRPLITFAVVQKRHHTKLFTVVDTVITHPTEFDFYLCSHWGVGTSRPTHYHVLWDENQFTSDELQKLVYNLCYTFVRCTKPVSLVPPVYYAHLAAYRRLYVD------S-PLP-KLSENV--SKVMFY- Linum_usitatissimum_LuAGO9 R-KGFGTGRPI-PLLTNHYRVSVLIDKLYQTY-SSEFDGKAYDGEKALYTV-GPL-PVEVN-YA-A-MIPMVQDAVRVLD-IILRQQAASRQSFFHD-DSRDIGQGVRGFHSSFRTTHGLSLNMVS-TTMVVSGPVIDFLARRMLKNLRIREFKIIGLSPQRCNQTVYEYFRHRGMQLRYFPCLDVGKP-KR-PYLPVELCSLVSLQRYTKAQRASLVEKSRQKPQDRAM-AKY-RYQDPLL-AECGISIQKDLTPVNGRVLDTPKLKGRWN--FNNKTLLRAVSIDKWGIVNFSAQRELNNGIRIEEGMFKQVG-FILCVLPQKKNSWKKKCLSDFGIVTQCIAKD-QYLTNVLLKINAKLGGVNSMLEIEQSRR-IPLITKVPTMILGIDVSHGPGRS-D-V--PSIAAVVGSLEWPYITRYSGAVRTQ-SPKVEMIDGLYKKLFVSFGQKPRQIVIF-RDGVSESQFNQVLNIELPQIIKAY-QHMGEVDVPKFTVIIAQKNHHTKLFTIVDTTIVHPRNYDFYMCAHNGAGTSRPAHYHVLIDEIGFSPDDLQNLVHSLSYVYQRSTTAISIVAPVCYAHLAAQQTQFMKGSSER-L-ELP-RLQDNV---TNMFF- Lotus_japonicus_LjAGO7 R-PDSGGGSVI-SLLANHFLVQFIKQKLVNNN-SAMLSGAAYDGRQNLYSS-IEF-QINIK-LV-S-KIDGPQDYLHALD-VVLRESPTEGRSFYSN-SMGDIGGGARGFFQSLRPTQGLALNLFS-VTAFHEIGVISYLVEKALKNIRVQRYRVYGLTEEATENRLVNYFDHYNYDIQFLPCLQISR--SK-PYLPMELCVICEGQKFLGKQTARILKMGCQRPGERVM-RGNVGSSGEQE-REFKLQVSREMTKLTGRILHPPKLKRQWN--LLDGNVFEGTTIERWALVSFGGTNQLCQGIFLNESKLKRIQ-LLICVMERKHKGLKRIAETSIGLISQCCLSS-QFLANLALKINAKVGGCTVALYNSLPSQ-LPRLIDEPVIFMGADVTHPPLDD-S-S--PSVAAVVGSMNWPTANKYISRIRSQ-THRQEIIQDL--ELLDDFEKLPNRIVFF-RDGVSETQFHKVMQEELQSIRHAC-ERFP-DYKPLITFAVVQKRHHTRLFTVVDSVITHPKEFDFYLCSHWGVGTSRPTHYHVLWDENQFTSDELQKLVYNLCYTFVRCTKPISLVPPAYYAHLAAYRRLYLELGLFR-N-PLP-KLSENI--KKLMFY- Malus_domestica_MdAGO10a R-PGYGQGIKC-VVKANHFFAELIMAELVRLYKESDLGMRAYDGRKSLYTA-GEL-PVVIK-FV-A-RANMPQEALQILD-IVLRELSNKGRSFFSP-DIRRLGEGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIEFVIKKALRGVKVRKYRVSGLTSQPTRESVIEYFEMYGFTIQHLPCLQVGNQ-KK-AYLPMEACKIVEGQRYTKRQITALLKVTCQRPRDRTV-QHN-AYQDPYA-KEFGIKISEKLASVEARILPAPWLKGQWN--MMNKKMINGMTVSRWACINFSRGSELAQGMEFNEKALKHVE-LLLAILPDNNGSIKRICETDLGLISQCCLSK-QYLANVSLKINVKMGGRNTVLLDAISCR-IPLVSDIPTIIFGADVTHPNGED-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKDLLVSFGQKPLRIIFYSRDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFIVVQKRHHTR?FTVVDTKICHPTEHDFYLCSHAGIGTSRPAHYHVLWDENNFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRRFYLEENGST---PLP-ALKENV--KRVMFY- Malus_domestica_MdAGO10b R-PGYGQGIKC-IVKANHFFAELIMAELVRLYKESDLGMRAYDGRKSLYTA-GEL-P--------------PQEALQILD-IVLRELSNKGRSFFSP-NIRRLGEGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIEFVIKKALRGVKVRKYRVSGLTSQPTRESVIEYFEMYGFTIQHLPCLQ--------------ACKIVEGQRYTKRQITALLKVTCQRPRDRTV-QHN-AYQDPYA-KEFGIKISEKLASVEARILPAPWLKGQWN--MMNKKMINGMTVSRWACINFSRGSELAQGMEFNEKALKHVE-LLLAILPDNNGSIKRICETDLGLISQCCLSK-QYLANVSLKINVKMGGRNTVLLDAISCR-IPLVSDIPTIIFGADVTHPNGED-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKDLLVSFGQKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFIVVQKRHHTRLFTVVDTKICHPTEHDFYLCSHAGIGTSRPAHYHVIWDENNFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRRFYLEENGST---PLP-ALKENV--KRVMFY- Malus_domestica_MdAGO10c R-PGKGTGIKC-IVKANHFFAELVMKRLVDLYRESHLGNRAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTAARSFYSP-DLGSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIEFVIKKALRGIKVRKYRISGLTSQATRESVVEYFETYGFIIKHLPCLQVGNQ-QR-SYLPMEVCKIVEGQRYSRRQITALLKVTCQRPYERTV-RQN-AYEDPYA-QEFGIKISENLTLVEARILPAPRLKGQWN--MMNKKMVNGGRVNNWMCINFSWSQELAQGMDFNERALKTRE-LLIAILPDNNGSLKRICETDLGIVSQCCLNKQQYLANVTLKINVKVGGRNTVLVDALSRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEITKYAGLVSAQ-THRQELIQDLFK------------------DGVSEGQFYQVLLYELDAIRKAC-ASLEPDYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFSADGLQTLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRRFYMEEGGSV-T-PLP-ALKENV--KRVMFY- Malus_domestica_MdAGO1a R-PGKGSGRRC-TVKANHFFAELVMEQLVTLYRESHLGKRAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTSGRSFYAP-GLGSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIEFVIKKALRGVKVRKYRISGLTSQATRESVVEYFETYGFVIQHWPCLQVGNQ-QR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPHDRTV-RHN-AYEDPYA-KEFGIKISENLAQVEARILPAPWLKGQWN--MMNKKMVNGGKVNNWICINFSRNNELAQGMAFNEKALKTRD-LLVVILPDNNGNLKRICETDLGLVSQCCLSK-QYLANVALKINVKVGGRNTVLIDALSRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEITKYAGLVCAQ-AHRQELIQDLFKELLISFGQKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFTADELQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSM-T-PLP-ALKENV--KRVMFY- Malus_domestica_MdAGO1b R-PGYGQGIKC-VVKANHFFAELIMAELVRLYKESDLGMRAYDGRKSLYTA-GEL-PVVIK-FV-A-RANMPQEALQILD-IVLRELSNKGRSFFSP-DIRRLGEGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIEFVIKKALRGVKVRKYRVSGLTSQPTRESVIEYFEMYGFTIQHLPCLQVGNQ-KK-AYLPMEACKIVEGQRYTKRQITALLKVTCQRPRDR--------------------------------------LKGQWN--MMNKKMINGMTVSRWACINFSRGSELAQGMEFNEKALKHVE-LLLAILPDNNGSIKRICETDLGLISQCCLSK-QYLANVSLKINVKMGGRNTVLLDAISCR-IPLVSDIPTIIFGADVTHPNGED-S-S--PSIAAVKSLMDWPEVTKYAGLVCAQ-AHRQELIQDLYKDLLVSFGQKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFIVVQKRHHTR?FTVVDTKICHPTEHDFYLCSHAGIGTSRPAHYHVLWDENNFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRRFYLEENGST---PLP-ALKENV----LVHH- Malus_domestica_MdAGO4 R-SGNGTGQKI-PLLTNHFKVAVVIDKVKQTY-AMELADKAYDGEKSLFTV-GPL-PVLIN-YA-T-KIPMFQEAVRVLD-IVLRQNAAKRQSFFHN-NPRDLGS-------------------VS-TTMIVKGPVLDFLAKRMLKNLRIMEYKITGLSDRPCKETVSKYFVYKNLPLRDFPCINVGKP-KK-PYFPLELCNLVSLQRYTKSQRASLVEKSRQKPQERAL-RTS-NYADLML-RSSGVSIGVDFVHVEGRVLPAPKLKGRWN--FNNKKLVQPVTIDRWAIVNFSARSNMMKGIAIKDKMFEYIQ-LLLCILPERKNSWKRKNLSELGIVTQCIAND-QYITNVLLKINAKMGGMNSLLSVEHSPS-IPLVSKRPTLILGMDVSHGPGRS-D-V--PSIAAVVSSRHWPLISRYRAAVRTQ-SPKVEMIASLFKELLVDFSRKPDQIIIF-RDGVSESQFNQVLNVELDQIIEAC-KFLDETWSPKFMLIVAQKNHHTKFFTIIDNKVCHPKNNDFYLCSHAGMGTTRPTHYHVLYDELGFSTDDLQELVHSLSYVYQRSTTAISVVAPICYAHLAAAQSQFIKSETAS-S-ELP-KLHKNV--INSMFF- Malus_domestica_MdAGO5a R-PGYGKGEKV-QVRANHFLVEVVIKQLLKLYKESHLGKRAYDGMKSIYTA-GPL-PVTLK-LA-S-KPDLPQDAIQVLD-VVLRAKPSEGRSFFAI-QLGDLGDGLRGFYQSLRPTQGLSLNIVS-ARAFYEILVTEFVVKKALKGVKVRSYKITGVSVEPLSKSVVQYYERYNIVLRDMPALQSGSD-SK-PYLPMELCSIVAGQRYTRKQVTALLRATCQRPGERMG-KHN-RYEDDLI-QQFGMNISQDMALVNARVLPPPTLKGQWN--MINKKMVNGGRVDFWACVNFS-REDLVNGVHFHERVLRDIQ-LLIIILPDVTGSIKRICETELGIVSQCCQSK-QYLENLSLKINVKVGGRNTVLIDAIQRR-IPHVSDIPTIIFGADVTHPPGED-S-S--PSIAAVVASMDWPEVTKYRGIVSAQ-AHREEIIQDLYSEHFRAFGRKPERIIFF-RDGVSEGQFSQVLLYEMDAIRKAC-QSLQEGYLPPVTFVVVQKRHHTRLFTVVDTQICHPTEFDFYLNSHAGIGTSRPAHYHVLFDENRFTPDALQMLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRYYIEDGGST-T-ALP-EIKENV--KEVMFY- Malus_domestica_MdAGO5b R-PGYGKGEKV-QVRANHFLVEVVIKQLVKLYKESHLGKRAYDGMKSIYTA-GPL-PVTLK-LA-S-KPDLPQDAIQVLD-VALRATPSEGRSFFAI-ELGDLGDGLRGFYQSLRPTQGLSLNIVS-ARAFYDVLVTVFVVKKALKGLKVRSYKISGVSVEPLNKSVEQYYDTYNIVLRDMPALQSGSD-SK-PYLPMELCSIVAGQRYTKKQVTALLRATCQRPGDRMV-KHN-AYKDELVQREFGMHIREDMALVNARVLPPPSLKGQWN--MINKKMVNGGRVDFWACVNFS-REDLVNGVHFHERVLRDIQ-LLIVILPDVTGSIKRICETELGIVSQCCQSK-QYLENLSLKINVKVGGRNTVLTDAIERR-IPRVSDIPTIIFGADVTHPPGED-S-S--PSIAAVVASMDWPEVTKYRGIVSAQ-VHREEIIQDLYTEHFRAFGQIPKRVIFF-RDGVSEGQFSQVLLYEMDAIRKAC-QSLQEGYLPPVTFVVVQKRHHTRLFTVVDTQICHPTEFDFYLNSHAGIGTSRPAHYHVLYDENNFTADALQMLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRYYIEDGGST-T-ALP-EIKENV--KEVMFY- Malus_domestica_MdAGO7a R-PDSGGGTVI-SLLANHFLVQFIKQKLMEDN-SAVLSGAAYDGRKNLYSA-LEF-RVNIK-LV-S-KLDAPQDYLHALD-VVLREAPLEGRSLYSS-SMGEIGGGARGFFQSLRLTQGLALNVFS-VTAFHEVGVIPYLVEKALKNIRVQRYRVFGLTEEATEDRLLTYFDHYNYDIQFLPCLQISR--SK-PYLPMELCMICEGQKFLGKQTARILKMGCQRPKERVM-RGPVGPSGIQE-REFKLHVSRDMTRLKGRVLQPPKLKRQWN--LMDSHVFEGTRIERWALISFGGTRQLSQGIFLNESKLKRIQ-LLICVMERKHKGLKRIADTSVGVLSQCCLGS-QFLANLALKINAKVGGCTVSLYNSLPSQ-IPRLADEPVIFMGADVTHPPLDD-F-S--PSVAAVVGS?NWPAANKYVSRMRSQ-THRQEIIQDL--ELLNEFGKLPKRIIFF-RDGVSETQFYKVLQEELQSIKRAC-SRLP-GYAPPITFAVVQKRHHTRLFTVVDTVITHPKEFDFYLCSHWGVGTSRPTHYHILRDENEFTSDELQKLVNILCYTYARCTKPVSLVPPAYYAHLAAYRRLYLETTYT?-S-ALP-KL?ENV--KKLMFY- Malus_domestica_MdAGO7b R-PDSGGGTVI-SLLANHFLVQFIKQKLIEDN-SAVLSGAAYDGRKNLYSA-VEF-QINIR-LV-S-KIDAPQDYLHALD-VVLREAPLEGRSLYSS-SMGEIGGGARGFFQSLRPTQGLALNVFS-VTAFHEVGVIPYLVEKALKNIRVQRYRVCGLTEEATENRLLTYFDHYNYDIQFLPCLQISR--SK-PYLPMELCMICEGQKFLGKQTARILKMGCQRPKERVM-RGPVGPSGIQE-REFKLHVSRDMTRLKGRVLQPPKLKRQWN--LINSHVFEGTRIERWALIGFGGTRQLSQGIFLNESKLKRIQ-LLMCVMERKHKGLKRIADTSVGILSQCCLGS-QFLANLALKINAKVGGCTVSLYNSLPTQ-IPRLAGEPVIFMGADVTHPPLDD-F-S--PSVAAVVGSMNWPAANKYVSRMRSQ-THRQEIIQDL--ELLNEFGKLPKRIIFF-RDGVSETQFYKVLQEELQAIKGAC-SNFP-GYAPPITFAVVQKRHHTRLFTVVDTVITHPKEFDFYLCSHWGVGTSRPTHYHILWDENLFTSDELQKLVNILCYTYARCTKPVSLVPPAYYAHLAAYRRLYLETTYTR-S-ALP-KLSENV--KKLMFY- Malus_domestica_MdAGO9 R-PGFGSGKNI-QLTTNHFKVGVVVEKVKETY-DRDLGRKAYDGQKNLFTV-GSL-PVLIN-YA-?-KI?MFQEAVRVLD-IILRQHAVKRQSFFRN-NPRDLGEGLSGFHSSFRATQGLSLNMVS-TTVIIKGPVLNFLAKRTLKNLRIMEYKITGLSDDSCKETVYDYFRHKHI-----------------P-----LCTLVPLQRYTKAQRSTLVGESRQKPQEREL-RSS-NYADRML-QSSGISISPEFMQVEGRVLSAPRLKGRWN--FSNMSFVEPVKIETWAIVNFSDFKT?LKGIAIHDK----------CII------WKGK-------------ND-QYITNVLLKINAKLGGMNTYLTAEYSRS-IPMASRSPTMILGMDVSHGPGRS-D-V--PSIAAVVGSRKWPSISHYRASVRTQ-SPKVEMIASLFKELLLDFSCKPAQIIIF-RDGTSESQFDQVLNDEMSQIIQAC-KFLDEGWSPKFMVIVAQKNHHTKFFTIIDRTVCHPTNNDFYLCAHAGMGTTRPTHYHVLLDQLGYSADDL?ELVHSLSYVFQRSTTAISVVAPIRYAHLAAAQSQFIDSETSS-S-ELP-KLHEDV--KNYMFF- Manihot_esculenta_MeAGO1 R-PGYGQGTKC-MVKANHFLAEIIMTQLVKLHRGTDLGMRVYDGGRNLYTA-RSL-PVTIK-FE-A-LASMPQEAITIID-IILREFAAQGRSFYSP-DIKKLDGGLRGFYQSIRPTQGLSLNIMS-ATAFIELLVIDFVVKKALRGVKVRKYRISGLTTQPTRESVVEYFEMYGYTIQYLPCLQVGNQ-RK-VYLPMEACKIVQGQRYTKGQITSLLKVSCQRPRDQTI-QQN-GYQDPYA-KEFGISIDSKLASIEARVLPAPWLKGQWN--MMNKKVINGSTVRYWACINFSRSQQLGQGMDFNKKALKYVE-LLIAILPDSNGSLKRICETDLGLISQCCLNR-QYLANVSLKINVKMGGRNTVLLDALSWR-IPLVSDIPTIIFGADVTHPSGED-T-S--PSIAAVVASQDWPEVTKYAGLVCAQ-PHRQELIQDLFKELLLSFGQKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPSYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADEIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAYRRFYMEENPKM---PLP-ALKDKV--KSVMFY- Manihot_esculenta_MeAGO10 R-PGYGQGTKC-VVKANHFFAELIMAELVRLYKESDLGMRAYDGRKSLYTA-GQL-PVVIK-FV-A-RANMPQEALQILD-IVLRELSTKGRSFFSP-DIRRLGDGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIEFVIKKALRGVKVRKYRVSGLTSQPTRESVVEYFEMYGFTIQHLPCLQVGNQ-KK-AYLPMEACKIVEGQRYTKRQITALLKVTCQRPRDRTV-QHN-AYQDPYA-KEFGIKISEKLASVEARILPAPWLKGQWN--MMNKKMINGMTVSRWACINFSRSNELAQGMEFNEKALKHVE-LLLAILPDNNGSLKRICETDLGLISQCCLSK-QYLANVSLKINVKMGGRNTVLLDAISCR-IPLVSDIPTIIFGADVTHPNGED-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKDLLVSFGQKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFIVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRRFYMEENGSS-G-PLP-ALKENV--KRVMFY- Manihot_esculenta_MeAGO4 R-RGFGSGQKI-SLLTNHFKVNVVIDRVQETY-DSELDGKAYDGEKSLFTI-GSL-PVEIS-FA-A-KIPMSQEAIRVLD-IILRQHAAKRQNFFHN-DPRDVGGGVKGFHSSFRTTQGLSLNIVS-TTMIIQGPVVDFLAKRTLKNLRIQEYKITGLSDKPCRETVYDYFNHRHIDLRYLPCINVGKP-KR-PYIPIELCTLVSLQRYTKAQRASLVEKSRQKPQERAL-KSS-KYAEPML-RSCGISISTNFADIEGRVLPAPRLKGRWN--FNNKKLVEPSKIERWAVVNFSARRDLTRGIPMEEKMFEEIK-FLLCLLPERKNSWKKKNLAEFGIVTQCLAND-QYLTNLLLKINAKLGGLNSMLSVEHTPS-IPVVSKVPTIILGMDVSHGPGHS-D-C--PSIAAVVSSRNWPLISRYRASVRTQ-SPKVEMIDSLYKELLLDFKRKPDQIIIF-RDGVSESQFNQVLNIELDQIIEAC-KFLDEKWNPKFVVIVAQKNHHTKFFTVIDNKVCHPRNNDFYLCAHAGMGTTRPTHYHVLLDEVGFSADDLQDLVHSLSYVYQRSTTAISVVAPICYAHLAATQGSFMKSETSS-S-QLP-KLQDKV--CNSMFF- Manihot_esculenta_MeAGO5 R-PGFGTGMKC-VVKANHFLVQVIISELVRMYRASHLGNRAYDGRKNLYTA-GPL-PVAIK-FA-S-KADLPQETVQVLD-IVLRASPSEGRSFFSP-DLGELGDGIRGYYQSLRPTQGLSFNVVS-ARSFFEIMVTDFVVKKSLKGVKVKSYKITSLSNQPMNQSVVQYFERYNIMLKYLPALQAGSD-SK-PYLPMELCRIVEGQRYTKKQVTQLLRATCQRPHDRMV-RRN-NYRDELVANEFGIQVKEELALVDARVLPPPMLKGQWN--MINKKMVNGGRVDFWTCVNFSSQQQLVQGMGFNERALADVQ-LLIIILPDFTGSIKRICETEFGIVSQCCQSK-QYFENVALKINVKVGGRNTVLNDAIQRR-IPLVTDLPTIIFGADVTHPPGED-S-N--PSIAAVVASMDWPEVTKYRGLVSAQ-AHREEIIQDLYKELLISFGHKPGRIIFY-RDGVSEGQFSQVLLHEMDAIRKAC-SSLEEGYLPRVTFVVVQKRHHTRLFTVIDTKICHPKEFDFYLNSHAGIGTSRPTHYHVLYDENGFTADGLQILTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRYYIEDSGSS-S-PLP-VIKDNV--KDVMFY- Manihot_esculenta_MeAGO7a R-PDSGGGSVV-TLVANHFLVQFIKEKLVQDN-SAVFSGTAYDGRKNLYSP-VEF-QINIK-LA-S-KLDGPQDYLHALD-VVLRESPMEGRSFYSS-LMGEIGGGARGFFQSLRPTQGLALNVFS-VTAFHEIGVIPYLVEITLKNIRVQRYRVYGLTEEATDNRLVSYFDHYNYDIKFLPCLQISR--SK-PYLPMELCMICEGQKFLGKQTAKILKMGCQRPKERVM-RGSVGPSGKQS-REFKLNVSREMTRLNGRILQPPKLRRQWN--LVDSHVFEGTRIERWALMSFGGTNQLSQGIFLTESKLKKIQ-LLICIMEKRHKGLKRIAETNVGVVSQCCLNP-QFLANLALKINAKVGGCTVALYNSLPSQ-IPRLSDEPVIFMGADVTHPPLDD-F-S--PSVAAVVGSMNWPETNKYASRMRSQ-THRQEIIQDL--ELLDEFRKLPKRIIFF-RDGVSETQFYKVLQEELRAIQEAC-SRYP-GYRPLITFAVVQKRHHTRLFTVVDTVITHPKEFDFYLCSHWGVGTSRPTHYHVLWDENQFTSDELQKLVYNLCYTFVRCTKPISLVPPAYYAHLAAYRRLYLEMASMR-N-PLP-KLNENV--KNLMFY- Manihot_esculenta_MeAGO7b R-PDSGGGHVI-TLLANHFLVRFIKQKLVEDN-SAVLSGAAYDGRKNFYSP-VEF-RINIK-LV-S-KLDGPQDYLHALD-VVLRESPMEGRSFYSS-SMGEIGGGARGFFQSLRPTQGLALNVFS-VTAFHEIGVIPYLVEKALKNIRVQRYRVFGLTEEATDNRLVSYFDHYNYDIKFLPCLQISR--SK-PYLPMELCMICEGQKFLGKQTAKILKMGCQRPKERVM-RGSVGPSGNQS-REFKLHVSREMTRLNGRILQPPKLRRQWN--LADSHVFEGTRIERWALISFGGTNQLSQGIFLSESKLKKIQ-LLICIMEKRHRGLKRIAETNVGVVSQCCLSS-QFLSNLSLKINAKLGGCTVALYNSLPSQ-IPRLSDEPVIFMGADVTHPPLDD-F-S--PSVAAVVGSMNWPAANKYASRMRSQ-THRQEIIQDL--ELLDDFNKLPKRIMFF-RDGVSETQFHKVLQEELKSIREAC-SRFP-CYKPPITFAVVQKRHHTRLFTVVDTVITHPKEFDFYLCSHWGVGTSRPTHYHVLWDENQFTSDELQKLVYNLCYTFVRCTKPVSLVPPAYYAHLAAYRRLYIE--SMR-N-PLP-KLSEKV--KNLMFY- Manihot_esculenta_MeAGOlike R-PGFGTGEKC-VVKANHFLVEIIISQLVRMYRESHLGNRAYDGRKSLYTA-GPL-PVAIK-FA-S-KANIPQETIQVLD-IVLRESPSEGRSFFST-NLGELGDGIRGYYQSLRPAQGLSFNIVS-ARSFFEIMVTDFLVKRALRGVKVKSCKIIDLSNQPLNQSVVQYFDRYNIGLKYLPAIQAGSD-SK-PFLPMEVCRIVEGQRYSMKQVTELLKATCQRPCARIV-MRN-DYSDKLVRNEFGIQVKEELTFIDARVLPPPMLKGQWN--MKNKKMVNGGRVEFWTCVNFSLKRQLIEGMGFNERALADVQ-LLIIILPDVMGSIKRICETELGIVSQCCQRR-PYFENVSLKINVKVGGRNTVLNDAIQRS-IPLVTDIPTIIFGADVTHPPGED-T-N--PSIAAVVASMDWPEVTKYRGNVSAQ-AHREEIIQDLYKELCIAFGHKPNRMIFY-RDGVSEGQFSQVLLHEMDAIRKAC-CSLEEGYLPRVTFIVVQKRHHTRLFTVIDTKICHQNEFDFYLNSHAGIGTSRPAHYHVLYDENCFTADKLQVLTNNMCYTYARCTRSVSVVPPAYYAHLAAFRRYYIEDGGPS-G-PLP-VIKDNV--KDVMFY- Medicago_truncatula_MtAGO10 R-PDYGKGTKC-VVKANYFLADIIIAKLVKFHQNTELGKKVYDGAENLYTA-GSL-PVAIK-FL-A-HVSMPQEAINAID-IVLKELASHGSLHYSP-DLKKLSGGLSGFYQSIRPTQGLSLNVMA-STAFIELPVIDIAIKKALKGVKVRKYRITGLTSQPTRESVIDYFEMYGYKIMYLPCLQVGSQ-KK-VYLPMEACKIVGGQRYTKGQITSMLKVSCQRPRERTI-HQN-DYCNPYA-KEFGISIGNELASVEARVLPAPWLKGQWN--MTNKKVVNGSKVRYWACINFSRSQQLVQGMEFSKKALKYVE-LVVAILPDNNGSLKKICETDLGLISQCCLNR-QYLSNVALKINVKMGGRNTVLLDAISCR-IPLVSDVPTIIFGADVSHPSGED-V-C--PSIAAVVASQDWPEVTKYAGLVCAQ-PPREEIIKDLFKELLLSFGKKPCRILFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPGYQPPVTFVVVQKRHHTRLFTVVDTKICHPTEFDFYLCSHAGVGTSKPAHYHVIWDDNKFSADEIQSLTNNLCYTYARCTRSVSLVPPAYYAHLAAYRRFYMEENAKS---PLP-ALKEKV--KKVMFY- Medicago_truncatula_MtAGO2 R-PDSGGVHTS-TLRVNHFPVKFIKEKLFSDD-PEKFPLDAHDGANNIFSA-VQL-PVTIT-LL-N-KLRLPRDILQGMD-VVIKENPVRGRYFYPT-NPPELRPGIGGFHHSLKPTSGLSLCVYS-VVPFRKMSVVDFLVEEVLIGLKVQKYIIAGLTPTVTRYGLLSFFDKYDKDIVYIPCLDLGKG-NK-KYVPMEFCVLAEGQRYPKESAKTLTAMALAHPSERMV-QSSDGPGGDLI-QNFGMRVSTTMTTILGRVIGPPELKCHWN--LSGRSMVEGKPVERWGILDFTSIEKLIGGIYMQSELLEKIQ-FLLCVMANKSPGLKWISETKVGIVTQCCLDD-KFYTYLALKINAKLGGSNVELNN----R-LPYFGEEHVMFIGADVNHPSRDN-K-S--PSIVAVVATINWPAANRYAARVCPQ-FNRSEKILNF--ELVSCYGVRPEKIVVF-RDGVSEFQFDMVLNEELLDLKRAF-QRL--NYFPTITLIVAQKRHQTRFFTVVDTKVTHPFEFDFYLCSYYGSGTSKPTHYHVLWDEHKFTSDELQKLIYEMCFTFARCTKPVSLVPPVYYADLAAYRRLYHEMQPKK-S-GFY-RLHADL--ENIMFF- Medicago_truncatula_MtAGO3 R-PDKGGIRDC-RLRVNHFPVAFIRDKLCADH-PQILPLLSYDGEKNIFSS-VPL-PVTIT-LV-N-KLELPRDILQGMD-LVVKENPARGRCFFPT-NPPDLEPGIGGFQHSLKTTAGLALCLYS-VLSFRKMSVLDFLVEEVLLGLKVQKYTIAKLTDKDTRHSLLAYFDKHNYDIQHIPALDFGG--NK-TFVPMELCVLVEGQRFPKEAAKNLKNMCLASPRDRMM-KSSDGPGGGIL-QNFGMNVNTSMTNVTGRVIGPPMLKCHWN--LVGKSMVEGKAVECWGILDFTSDNNLMDGIVMNCELLEKIQ-FLLCVMANKDPGLKWIAETKVGIVTQCCLKD-QYLTNLALKINAKIGGSNVELIN----R-LPHFDESHVMFIGADVNHPSRDT-N-S--PSIVAVVATTNWPAANRYAARVCAQ-EHCTEKILNF--DLVRHYKVRPQKIVIF-RDGVSESQFHMVLGEELKDLKTVF-QHS--NYFPTITLIVAQKRHQTRLFTVVDTKVVHPFEFDFYLCSHYGSGTSKPTHYHVLWDEHRFTSDNLQKLIYDMCFTFARCTKPVSLVPPVYYADLAAYRRLYYETQSPY-S-GFY-KLHPDT--ENGMFF- Medicago_truncatula_MtAGO4a R-RGLGTGNKL-SLLTNHFKVNAILDKVKKTY-DSELRGKAYDGEKTLFTM-GSL-AVEIN-YA-S-KIPLYQEALRVLD-TILRQHAAKRQSFFHN-DPRNVGGGVRGLHSSFRTTQGLCLNIVS-TTMIVQGPVVDFLAKRTLKNLRIQEFKITGLSERPCKDTIYEYFNRRKIPLKYLPCINVGKP-KR-PYFPIELCSLVSLQRYTKAQRASLVEQSRQNPLERAL-QTS-NYSEPML-RTCGITIKPHLTQVDGRVLQAPRLTGRWN--FNNKKIAQPVTIANWAVVDFSNYRDLIKGIHIEEKMFQEMK-FILCLLPQ-KNCWKKKNLAEEGIITQCIVND-QYLTNVLLKINAKLDGINSFLGIEHARS-MPIVSREPTLILGMDVSHGPGQS-E-I--PSIAAVVSSRQWPLISKYRACVRTQ-GSKVEMIDNLFKELLVDFQRKPANIIIF-RDGVSESQFNQVLNVELGQIIEAC-KFLDEDWNPKFLLIVAQKRHHTKFFTVVDNKICHPRNYDFYMCSHAGRGTTRPTHYHVLLDEIGFSPDELQEFVHSLSYVYQRSTTAVSVVAPICYAHLAASQAQFMKSETSS-R-QLP-KLDRRV--CNSMFF- Medicago_truncatula_MtAGO4b R-RGLGSGAKL-PLLTNHFKVNVILDRVQETY-GSELNGKAYDGEKTLFTI-GSL-AVEIS-FA-S-KIPLYQEAIRVLD-IILRQHAAKRQNFFHN-DPKDVGGGVRGLHSSFRTTQGLSLNIVS-TTMIVHGPVVDFLAKRTLKNLRIQEYKITGLSEMPCKDTVYDYFNRRKISLQYLPCINVGKP-KR-PFVPVELCSLVSLQRYTKAQRSSLVEKSRQKPQERAL-KTS-DYSEPML-RNCGISITSGFTQVDGRVLQAPRLKGRWN--FNNKKIVQPVKIEKWAVVNFSARRDLIKGIHVEEKMFEHVK-FLLCLLSERKNSWKKKNLAEFGIVTQCIAND-QYLTNVLLKINAKLGGMNSLLGVEHSPS-IPIVSKAPTLILGMDVSHGPGQT-E-I--PSIAAVVSSRQWPLISKYRACVRTQ-GAKVEMIDNLFKELLIDFNRKPDNIIIF-RDGVSESQFNQVLNIELSQIIEAC-KFLDEKWNPKFLVIVAQKNHHTKFFTVVDNKICHPRNYDFYMCAHAGMGTSRPTHYHVLLDEIGFSPDDLQELVHSLSYVYQRSTTAISVVAPICYAHLAASQGQFMKSETSS-S-QLP-KLMDSV--CNSMFF- Medicago_truncatula_MtAGO4c R-RGLGSGAKL-PLLTNHFKVNVILDRVQETY-GSELNGKAYDGEKTLFTI-GSL-AVEIS-FA-S-KIPLYQEAIRVLD-IILRQHAAKRQNFFHN-DPKDVGGGVRGLHSSFRTTQGLSLNIVS-TTMIVHGPVVDFLAKRTLKNLRIQEYKITGLSEMPCKDTVYDYFNRRKISLQYLPCINVGKP-KR-PFVPVELCSLVSLQRYTKAQRSSLVEKSRQKPQERAL-KTS-DYSEPML-RNCGISITSGFTQVDGRVLQAPRLKGRWN--FNNKKIVQPVKIEKWAVVNFSARRDLIKGIHVEEKMFEHVK-FLLCLLSERKNSWKKKNLAEFGIVTQCIAND-QYLTNVLLKINAKLGGMNSLLGVEHSPS-IPIVSKAPTLILGMDVSHGPGQT-E-I--PSIAAVVSSRQWPLISKYRACVRTQ-GAKVEMIDNLFK-----------------RDGVSESQFNQVLNIELSQIIEAC-KFLDEKWNPKFLVIVAQKNHHTKFFTVVDNKICHPRNYDFYMCAHAGMGTSRPTHYHVLLDEIGFSPDDLQELVHSLSYVYQRSTTAISVVAPICYAHLAASQGQFMKSETSS-S-QLP-KLMDSV--CNSMFF- Medicago_truncatula_MtAGO4d R-RGLGTGAKL-PLLTNHFEVNVIIDKVQETY-DSELNGKAYDGE-TLFTI-GSL-AVEIN-FA-K-EIPLYQEAIRVLD-IILRQHSAKRQNFFHN-DPNDVGGGVKGLHSSFRTTQGLSLNIVS-TTMIVRGPVVDFLAKRTLKNLRIQEYKITGLSELSCKDTVYDYFHRRKIDLQYLPCINVGKP-KR-PYIPIELCSLISLQRYTKAQRSSLVEKSRQKPVERAL-KAS-NYSEPML-RNCGISITSEFTQVDGRVLQAPRLKGRWN--FNNKKFVEPVSLGNWSVVNFSARRDLIKGILVEEKMFADVS-FLLCLLPERKNSWKKKNLAEFGIVTQCIAND-QYLTNVLLKINAKLGGMNSWLGVEHSRS-IPIVSKVPTLILGMDVSHGPGQP-D-I--PSIAAVVSSRKWPLISKYRACVRTQ-GSKVEMIDNLFKELLLDFERRPENIIIF-RDGVSESQFNEVLNVELSQIIEAC-KFLDENWNPKFMVIVAQKNHHTKFFTVVDSKICHPRNYDFYMCAHAGMGTSRPTHYHVLLDEIGFSPDDLQELVHSLSYVYQRSTTAISVVAPICYAHLAASQGQFMKSETSS-S-QLP-NLHKRV--CNSMFF- Medicago_truncatula_MtAGO4e R-RGLGSGAKI-QLLANHFRVGLVIDKLCETY-DV-LRNKAYDGEKSLFTL-RSL-HVEIS-HV-S-KIPLYQEAFNFLD-TILRQNAAKHKSYFHD-NQKNLEGGIRGFHSSFRVTQGLSLNVVS-TTLLVKGPVVDFLAKRMLKNLRITQRKITGLSEKSCMTTIYEYFRHKKIELCYMPCINVGKP-KR-PYYPMELCTLVSLQRYTKPQRAQLILESRTSPRERSL-RNS-RYDEPML-RSLGITIEPSFTQVDGRVLQPPTLIGSWN--FNDKKLIEPVKIKRWAIVNFSSQSMIKKGMLIDARMYEMVQ-LLLCILPVSRNCWKRRCLVDEGIATQCIAND-HYIINVLLKINAKLGGMNSFLLTEFKHS-IPLFSKIPTLVIGMDVSHGQGQS-E-A--LSIAAVVSSRCWPQISRYKAVVRTQ-SSKVEIVQSLFKELLKDF-VKPQQIIIF-RDGVSESQFNQVLNIELNEIIKAC-KCYDESWCPKFTLIVAQKNHHTRFFTVIDNTICHPKDNDFYMCAHAGRGTSRPTHYHVLYDEIGFSADNLQEFVHSLCYVHQRSTNAISIVAPIYYADLAAAQAQFIKSENLS-STELP-RLHERV--ADSMFF- Medicago_truncatula_MtAGO6 R-PSVGTGKRI-HLLANFFKAAALINRLHQTY-SSELGGKAYDGERTLYTV-GPL-PVEIS-FA-A-KIPLSQDALRVLD-TVLRQQAANRQSFFHN-DLRDVGGGVRGIHSSFRLTEGLSLNMVS-TTTIVKGPVIDFLAKRILKNLRVQEFKISGMSEKPCIQTVYEYFKHRGIELTSFPCLDVGKP-NR-PFLPLELCSLVPLQRYTKAQRASLVEKSRQKPQEKAI-GNS-GYDDAVL-AACGISIDKQFTPVEGRVLEAPKLKGRWN--FKTKKFLQPSHIGYWAVVNFSKQRELIKGMNIEEKMFSLLK-LILCVLPERKNCWKRKCLSDVGVVTQCISTD-QYLTNVLLKINSKLGGINSLLAIEHSGH-LPLIKDTPTMILGMDVSHGPGRS-D-I--PSIAAVVGSRCWPLISRYRASVRSQ-SPKVEMIDSLFKELLLDFNRRPTQIILF-RDGVGESQFQHVLDIELNQIIKAY-KHID-GDVPKFTVIVAQKNHHTKLFTVVDTNIVHPRNYDFYMCAHAGMGTSRPVHYHVLLDEIGFSSDGLQNLINSLSYVNQRSTAATSIVAPIYYAHHAAAQRKFMNSEASP-S-ELP-KLHSDV--RDSMFF- Medicago_truncatula_MtAGO7 R-PDSGGGPVI-SLLANHFLVKFIKHKLVNNN-AEILSGAAYDGRKNLYSP-IEF-QINIK-LV-S-KIDGPQDYLHALD-VVLRESPTEGRSFYSS-SMGDIGGGARGFFQSLRPTQGLALNVFS-VTAFHEIGVIPYLVEKTLKNIRVQRYRVYGLTEEATENRLMSYFDHYNYDIQFWPCLQISR--SK-PYLPMELCVICEGQKFLGKQTAKILKMGCQRPGERVM-RGNVGPSGDQE-KEFKLQVSREMTKLTGRILYPPKLKRQWN--FLDGHVFEGTTIERWALISFGGTNQLTQGIFLNESKLKRIQ-LLICIMEKKHKGLKRIAETSVGVVSQCCLSS-QFLANLALKINAKVGGCTVALYNSLPSQ-LPRLIDEPVMFMGADVTHPPLDD-S-S--PSVAAVVGSMNWPTANKYISRIRSQ-THRQEIIADL--ELLEDFEKLPNRIIFF-RDGVSETQFYKVLQEELQSIKQACSSRFH-GYKPFITFVVVQKRHHTRLFTVVDSVITHPKEFDFYLCSHWGVGTSRPTHYHVLLDENKFTSDELQKLVYNLCFTFVRCTKPISLVPPAYYAHLAAYRRLYLELGLFR-S-PLP-KLSENI--KKLMFY- Mimulus_guttatus_MgAGO1 R-PGKGSGTRC-IVKANHFFAELVMAQLVKHYRDSHLGKRAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTSGRSFYSP-DLGPLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVIKKALRGVKVRKYRISGLTSQATRESVVEYFETYGFVIQHWPCLQVGNT-QR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPQERTV-HHN-AYEDPYA-KEFGIKISEKLAQVEARVLPPPWLKGQWN--MMNKRMVNGGTVNSWICINFSRNHELAQGMAFNERVLKARD-LLIVILPDNNGSLKRICETDLGIVSQCCLSK-QYLANVSLKINVKVGGRNTVLVDALSRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKELLISFGQKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPTVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFTADALQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSM-T-PLP-QLRDNV--KRVMFY- Mimulus_guttatus_MgAGO10 R-PGFGQGTKC-IVKANHFFAQLIIAELVKVYKESDLGKRAYDGRKSLYTA-GEL-PVAIK-FV-A-RANLPKEALQILD-IVLRELSVKGRSFFSP-DIRRLGDGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIEFVVKKALRGVKVRKYRVCGITTQPTRESVVEYFEMYGFTIQHLPCLQVGNQ-KK-AYLPME-----------------------------TV-QHN-AYEDPYA-NEFGIKISEKMTSVEARVLPAPWLKGQWN--MMNKKMINGMNVNRWACINFSRSNELAQGMEFNEKALKHVE-LLLAILPDNNGSLKRICETDLGIISQCCLNK-QYLANVSLKINVKMGGRNTVLLDAISCR-IPLVSDIPTIIFGADVTHPNGEE-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKDLLVSFGQKPQRIIFY-RDGVSEGQFYQVLLFELDAIRKAC-ASLEPNYQPPVTFIVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRRFYLEESGSG-G-PLP-ALKENV--KRVMFY- Mimulus_guttatus_MgAGO4 R-RGLGTGNKV-PILTNHFKVNVVLDRVHETY-DSELAGKAYDGEKSLFTV-GPL-PVEIS-FA-A-KIPMSQEALRVLD-IILRQHAAKRQSFFHN-DPKDVGGGVRGFHSSFRTTQGLSLNIVS-TTMIIQGDVANFLAKRTLKNLRIQEFKITGLSEKSCRETVYDYFNQRNIDLRFLPCINVGKP-KR-PYFPVELCSLVSLQRYTKAQRASLVEKSRQKPQERAL-KIN-KYSEPML-RACGVSINNNFTQVEGRVLPAPKLKGRWN--FNNKRFVNACKVERWAVVNFSARRDLIKGIIVEEKMFEEVK-FLLCLLPERKNCWKRKNLSEFGVVTQCLAND-QYLTNLLLKINAKLGGLNSVLASELSPT-IPMVSKLPTLILGMDVSHGPGQS-D-I--PSIAAVVSSRQWPSVSRYRACVRTQ-SPKMEMIDSLFKEALLDFKRKPDQIIIF-RDGVSESQFNQVLNIELSQIIEAC-KFLDEKWNPKFVVIIAQKNHHTKFFTVIDNKVCHPRNNDFYLCAHAGMGTTRPTHYHVLLDEMGFSTDDLQELVHSLSYVYQRSTTAISIVAPICYAHLAATQGQWMKSETSS-S-PMP-KLSESV--RNSMFF- Mimulus_guttatus_MgAGO5 R-PGLGSGQKT-VVKANHFLVSVIMNQLVKTFHSSHLGKRAYDGRKSCYTA-GPL-PVSIK-FA-S-KADLPQETIQFLD-VVLREKPSNGRSFFHP-EF-ELGNGLKGFYQSLRPTQGLSLNIMS-ARAFFEIYVSEFVVRRALKGVKVKHHKITGLSTEPTQRSVYQYFQKYNIVLKYLPALQAGSA-AR-PYLPMEVCKIVAGQRYSKKQVTQLLRATCKRPEERMV-EKN-NYNDELVNAEFGIQVRPDLLSIEARVLPPPMLKGQWN--MMNKKMINGGTVDFWTCVNFS-RNKLLEGMKFGEQSLNAIQ-LLLIILPDVTGSIKRVCETELDIVSQCCQNI-QYLENVSLKINVKAGGRNTVLEQALLRK-MPYISDIPTIIFGADVTHPPGED-S-S--PSIAAVVASMDWPEVTKYRGLVSAQ-GHREEIIQDLYTEHLVAFKCKPSRLIFY-RDGVSEGQFNQVLLYEIDAIRKAC-ASLQADYQPRITFVVVQKRHHTRLFTVVDTKICHPNEFDFYLCSHAGIGTSRPAHYHVLYDENRFSADALQILTNSLCYTYARCTRSVSIVPPAYYAHLAAFRRYYIEDSGSA-A-ALP-AIMDNV--KDVMFY- Mimulus_guttatus_MgAGO6 R-PGFGTGKRI-SLLANHFKVSIVIDKLYQTY-SSELAGKAYDGDASLYTV-GPL-PVEIS-YA-A-KVPLAQDALRVLD-IVLRQDAAKGQSFFHD-DSRDVGGGVRGFHSSFRPTLGLSLNMAS-TTLILTGPVVDFLAKKMLKNMRVMEFKIAGLSEKPCNQTVYDYFKHRNIELISMPCIDVGKP-KR-PYLPIELCSLVSLQRYTKAQRASLVEKSRQKPPEKAI-KNS-HYENPVL-VACGISVEKHLSQLDGRILDAPKLKGRWN--FNNKKLLNPSQIDHWALVNFSARRELINGIHIEEKMVEHIE-FLLCVLPERKNCWKRKCLCNLGIVTQCVSND-QYLTNVLLKMNSKLGGINSLLAIENSRR-IPLITDKPTMILGMDVSHGPGRS-D-I--PSIAAVVGSRSWPLISRYRAAVRTQ-SSRVEMIESLFKELLKDFGRKPTQIIIF-RDGVSESQFTQVIDIELNQIIKAY-QHLGETEIPKFTVIVAQKNHHTRLFTVVDTNIVHPTNYDFYMCSQAGKGTSRPAHYHVLLDEIGFSPDDMQNLIHSLSYVYQRSTTAISIVAPVCYAHLAAQQSQFIKSEQKN---ELP-RLHKNV--AGSMFF- Mimulus_guttatus_MgAGO7 -------------------------------------------------AP-VEY----------------PQEYIHALD-VVLREGPTEGRSFYSS-SVGEIGGGARGFFQSLRPTQGLALNVFS-VTAFHEIGVIPYLVEKALKNMRVQRYRVYGLTEKVTEDRLTSYFEQYGYDIQYLPCLQISR--RK-PYLPMELCVICEGQKFLGKQTAKILKMGCQRPKERVM-KGSFGPSGDQG-KEFKLRVSKEMTRLTGRILQPPKLKRQWN--LLDSHVFESTRVERWAIMSFGGTNHLSQGIYLHESKLKKIQ-LLVCVMERKHKGLKRIAETRIGIVSQCCLSS-QFLANLALKINAKVGGCTVALYNTLPSQ-IPRLQEDPVIFMGADVTHPPLDD-S-T--PSVAAVVGSVNWPASNKYVSRMRSQ-THRQEIIEDL--EILEDFSKLPTRIVFF-RDGVSETQFHKVMHEELKAIKEAC-SRFS-DYAPPITFAVVQKRHHTRLFTVVDSVIVHPREFDFYLCSHWGVGTSRPIHYHVLWDENKFTSDEVQKLVYNLCYTFVRCTKPVSIVPPVYYAHLAAYRSLYLDS-------PLP-KLSENI--RKLMFY- Mimulus_guttatus_MgAGO9 R-SGFGSGQPI-PLLTNHFKVAVILEKVYDTY-AAELDRKAYDGEKTLFTV-GPL-PVAIN-FA-A-KIPMFQDAVRVLD-IMLRQHASQRQSFFHN-EPRDLGGGVRGFHSSFRATQGLSLNMVS-TTMIVKGPVLDFLAKRTLKNLRILEYKISGLSDSICRKTVYDYFNHRDIKLRYFPCINAGKP-KR-PYIPIELCELVSLQRYTKSQRASLVEKSRQKPMERAL-ATS-NYADPLI-VASGVSISTEFTKIQGRVLPAPKLMGRWN--FNSKRLIEPVKLDRWAVVNFSARESIVKGMTISEQMMELIQ-LLLCILPEKKNCWKKKNLSDMGIVTQCMAND-QYTTNLLLKINAKLGGINSLLGIEKSPS-IPLVSTVPTLIVGMDVSHGPGRS-D-V--PSIAAVVSSRQWPLISKYRAAVRTQ-SPKLEMIDSLFKELLQDFKRKPEQIIIF-RDGVSESQFNQVLNIELEQIIEAC-KFLDETWSPKFMVVVAQKNHHTKFFTVIDNGICHPRTNDFYMCAHAGMGTTRPTHYHVLFDELGFSADALQELVHSLSYVYQRSTTAISVVAPICYAHLAAAQSQFIKSDKSS-S-PLP-LLHHKV--SSSMFF- Nicotiana_attenuata_NaAGO10 R-PGYGQGTKC-IVKANHFLAELILAELVKLYKESDLGMRAYDGRKSLYTA-GEL-PVVIK-FV-A-RANVPQEALQILD-IVLRELSIKGRSFFSP-DIRPLGDGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIEFVIKKALRGVKVRKYRVSGLTSQPTRESVVEYFEMYGFTIKYLPCLQVGNQ-KK-AYLPMEACKIVEGQRYTKRQITALLKVTCQRPRDRTV-QHN-DYEDPYA-KEFGIKISEKQASVEARVLPAPWLKGQWN--MMNKKMINGMTVSRWACINFSRSNELAQGMEFNEKALKHVE-LLLVILPDNNGSIKRICETDLGLISQCCLSK-QYLANVSLKINVKMGGRNTVLLDAISCR-IPLVSDIPTIIFGADVTHPNGED-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKDLLVSFGQKPQRIIFY-RDGVSEGQFYQVLLFELDAIRKAC-ASLEPNYQPPVTFIVVQKRHHTRLFTVVDTKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRRFYMEENGGS---PLP-ALKENV--KRVMFY- Nicotiana_attenuata_NaAGO1a R-PGKGSGIRC-IVKANHFFAELVMEQLVKLYRESHLGKRAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPMSGRSFYSP-NLGPLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPIIDFVIKKALRGVKVRKYRISGLTSQATREAVVEYFETYGFVIRHLPCLQVGNT-QR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPQERTV-HHN-AYDDPYA-KEFGIKISEKLAQVEARVLPAPWLKGQWN--MMNKKMVNGGTVNNWICVNFSRNSELAQGMNFNERVLKTRD-LLIVILPDNNGSLKRICETELGIVSQCCLSK-QYLANVSLKINVKVGGRNTVLVDALSRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEITKYAGLVSAQ-AHRQELIQDLYKELLISFGQKPQRIIFY-RDGVSEGQFYQVLLFELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADALQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSV-T-PLP-ALKENV--KRVMFY- Nicotiana_attenuata_NaAGO1b R-PGKGSGMRC-IVKANHFFAELVMAQLVKLYKESHLGKRAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPTSGRSFYSP-DLGPLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVIKKALRGVKVRKYRISGLTSQATRESVIEYFETYGFVIQHWPCLQVGNQ-QR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPQERTV-HHN-AYNDPYA-KEFGIKISDKLAQVEARILPPPRLKGQWN--MMNKKMVNGGTVNNWICINFSRNSELAQGMNFNERVLKTRD-LLVVILPDNNGSLKRICETELGVVSQCCLSK-QYLANVALKINVKVGGRNTVLVDAISRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEITKYAGLVSAQ-AHRQELIQDLYTDLLISFGQKPQRIIFY-RDGVSEGQFYQVLLFELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFTADALQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDGGSV-T-PLP-ALKDNV--KRVMFY- Nicotiana_attenuata_NaAGO1c R-PGRGSGIRC-TVKANHFFVELVMEQLVKLYRESHLGKRAYDGRKSLYTA-GPL-PVVIK-LA-S-RADLPQEALQVLD-IVLRELPTAARSFYSP-DLGPLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVIKKALRGVRVRKYRISGLTSQATRESVVEYFETYGFVIQHWPCLQVGNQ-QR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPQQRTV-RHN-AYDDPYA-KEFGIKISERLAQVEARILPAPWLKGEWN--MKNKKVVNGGTVSNWICINFSRNSELAQGMNFNERVLKTRD-LLIAILPDNNGSLKRICETDLGIVSQCCLSKQQYLANVALKINVKVGGRNTVLVDALSRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEITKYVGLVSAQ-AHRQELIQDLYKELLISFGQKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADALQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYLEDGGSV-T-PLP-SLKENV--KRVMFY- Nicotiana_attenuata_NaAGO2 R-PDTGKVKSI-RLLANHFPVRFIRDKLFADN-PVQFPIDAYDGEKNIFSA-VQL-PFTIK-FV-A-ELKLPRDVLQGMD-LVMKENPSRGRSFYSN-EHLDFGFGVRGFQQSLKPTSGLALCLYS-VLAFRKVPVLDFLAEDALVGLKVQKYVVKKLTDEKTRDFLVDYFEKYQKEIRYLPSLDLGKG-NK-KYVPMEFCVLIEGQRYPKESALFMKKISLVPPRERMV-RAEDGP-GAVT-RNFEIGVDRNMTCVSGRILPAPDLKCQWN--LVGKSVVEGKALQRWALIDFSSQFRLKEGINMEEDLLRGVQ-MIVCVMAAKHNGLKWVSETKIGVVTQCCLQD-QYLANLCIKINAKLGGSNMELME----R-LPNFGEDNVMFIGADVNHPARNV-T-C--PSIAAVVATVNWPAANRYAARVCPQ-DHRTEKILNF--DLLNAYSVKPNRIVVF-RDGVSEGQFDMVLNEELVDLMKAI-YDD--HYRPAITLVVAQKRHHTRLFTVVDTVIVHPSDFDFYLCSHFGGGTSKPTHYHVLWDENGFNSDRLQKLTYNMCFTFARCTKPVSLVPPVYYADLVAYRRMFQEMQSPV-S-GFY-NLHPDL--QNIMFF- Nicotiana_attenuata_NaAGO4a R-HGLGSGQKI-PILTNHFKVNVVLDRVHETY-DTELAGKAYDGEKSLFTI-GSL-PVEIS-FA-A-KIPMSQEALRVLD-IILRQHAAKRQSFFHN-DPKEVGGGVRGFHSSFRTTQGLSLNIVS-TTMIIQGPVVDFLAKRTLKNLRVQEFKITGLSEKSCRETVYDYFNHRNIDLRYLPCINVGKP-KR-PYFPVELCSLVSLQRYTKAQRSSLVEKSRQKPQERAL-KTN-NYAEPLL-RASGISISSNFTQVEGRVLPAPKLKGRWN--FNNKRFFDPAKVERWAVVNFSARRDLTRGISVEEKMFEEIK-FLLCLLPERKNCWKRKNLADYGIVTQCLAND-QYLTNLLLKINAKLGGLNSVLAVEHSPS-IPMVSKVPTMILGMDVSHGPGQS-D-V--PSIAAVVSSRQWPSISRYRASVRTQ-SPKVEMIDNLFKELLLDFKRKPEHIIIF-RDGVSESQFNQVLNIELDQLIEAC-KFLDEKWSPKFVIIVAQKNHHTKFFTIIDNKVCHPRNYDFYLCAHAGMGTTRPTHYHVLLDEVGFSPDDLQDLVHNLSYVYQRSTTAISIVAPVSYAHLAATQGQWMKSETSS-S-QLP-RLQENV--SSSMFF- Nicotiana_attenuata_NaAGO4b R-RGLGNGQKI-QILTNHFKVNVVLDRVHETY-DTELAGKAYDGEKSLFTI-GAL-PVEIS-FA-A-KIPMSQEALRVLD-IILRQHAAKRQSFFHN-DPKDVGGGVRGFHSSFRTTQGLSLNIVS-TTMIIQGPVVDFLAKRMLKNLRVQEYKITGLSERSCKETVYDYFNHRNIDLRYLPCINVGKP-KR-PYFPIELCNLVSLQRYTKSQRSSLVEKSRQKPQERAL-KIN-KYAEPLL-RACGISISSNFTQVEGRVLSPPKLKGRWN--FNNKRLVDPTKIERWAVVNFSARSDLIKGIMVEEKMFEEVK-FLLCLLPERKNCWKRKNLAEFGIVTQCIAND-QYITNVLLKINAKLGGLNSMLTVEHAPA-IPMVSKVPTIILGMDVSHGPGQS-D-V--PSIAAVVSSRQWPSISRYRASVRTQ-SPKVEMIDNLFKEALLDFKRKPEHIIIF-RDGVSESQFNQVLNIELDQIIEAC-KFLDEKWSPKFTVIIAQKNHHTKFFTIIDNKVCHPRNYDFYLCAHAGMGTTRPTHYHVLYDEIGFSPDDLQELVHNLSYVYQRSTTAISVVAPICYAHLAATQGQWMKSETSS-S-QLP-KLEEKV--SSSMFF- Nicotiana_attenuata_NaAGO5 R-PGYGTGRKC-LIRANHFLVHVIMSQLVNDYKQSHMGGRAYDGGKSVYTA-GPL-PVSIK-FA-A-KADLPQETIQALD-VVLRASPSAGRSFFHK-TLGLLTDGLKGYYQSLRPTQGLSLNIMS-ARAFYEIYVYEYVVKRVLKGVKVRRYRISGLSAQPVKESVVDYFQKYNIVLRFLPAIQAGSD-AK-PYLPMEICRIVPGQRFTKMQVTEMLKATCQRPVDRIV-SSN-NYADEMV-KEFGIEVRSELTTIEARVLQPPMLKGQWN--MINKKMVNGGKVDTWTCVSFS-RKALIEGMVFNEKTLVDIQ-LLIVILPEVTGYIKRVCETDLGIVSQCCQNK-QYLENLALKINVKVGGRNSVLEQAVHGR-IPFLTDIPTIVFGADVTHPPGED-S-S--PSIAAVVASMDWPEVSQYRCLVSAQ-PHRKEIIEDLYQELLIAFGIKPGRIIFY-RDGVSEGQFNQVLLEEMDAIRKAC-SSLEEGYLPRVTFVVVQKRHHTRLFTVVDTKICHPMEFDFYLCSHAGIGTSRPTHYHVLFDENGFTADAIQNLTNFLCYTYARCTRSVSIVPPAYYAHLAAFRRYYLEDTGST-S-PLP-KIKDNV--RDVMFY- Nicotiana_attenuata_NaAGO7 R-PDSGGGQVI-SLLANHFLVKFIKQKLVEEH-SLVLSGAVFDGGRTIYSP-IEF-QVNIK-LI-S-KFDGPQEYLHALD-VVLRESPTDGRSFYSS-CMGDIGGGARGFFQSLRPTQGLALNVFS-VTAFHEIGVIPYLVEKALKNIRVQRYRICSLTEEVTENRIVNYFDHYNYDIQYLPCLQISR--SK-PYLPMELCMICEGQKFLGKQTARILKMGCQRPRERIV-TGSVGPSGNHA-RDFKLQISREMTPLYGRILQPPKLKRQWN--LLDSHVFEGTRIERWALMSFGGTNQLCQGIFLNETKLKKLQ-LVICVMEKKHKGLKRIAETNIGVVTQCCLSS-QFLANLALKINAKVGGCTVALYNSLPSQ-IPRLHDGPVIFMGADVTHPPLDD-S-S--PSVAAIVGNVNWPAANKYVSRMRSQ-THRQEIIQDL--EILDDFLKLPERIIFF-RDGVSETQFLKVLKEELQAIRVAC-SRFP-GYKPPITFVVVQKRHHTRLFTVVDSVITHPREFDFYLCSHWGVGTSRPIHYHVLWDENQFTSDELQKLVYNLCYTFVRCTKPISLVPPAYYAHLAAYRRLYLEATLTR-S-PLP-KLTENI--KKLMFY- Nicotiana_attenuata_NaAGO8 R-PGNGTGRGI-ALLANHLKVSVIIDKIHETY-SSEFAGKAYDGEKSLYTV-GPL-PVEIN-FA-A-KIPLVQDALRVLD-IILRQQAANKQSFFHD-DSRDVGGGVKGLHSSFRPTLGLTLNMVS-TTMILSGPVIDFLAKRMLKNLRVKEFKIVGLSERPCNQTVYEYFKHRNIELSNMPCLDVGKP-KR-PYLPLELCYLVSLQRYTKAQRASLVEKSRQKPRERAV-RDY-SYDDPLL-ATCGVSIEKQLIQFNGRVLEAPKLKGRWN--FNNKHLLTPARIERWAVVNFSARRELISGIHFEEKMFEEID-FLLCVLPERKNSWKKKSLTDLGIVTQCISND-QYLTNVLLKINAKLGGTNSLLAMEHASY-LPHIQDTPTMILGMDVSHGPGQS-D-I--PSIAAVVGSLYWPLISKYRAVVRSQ-SPKLEIIESLYKELLLDFGHKPAQIIVF-RDGVSESQFSQVLNLELDQMIKAY-KHLGEGDIPKFTLIVAQKNHHTKLFTVVDTNIVHPRNNDFFMCAHAGMGTTRPAHYHVLLDEIGFSPDVLQNLIHSLSYVYQRSTTATSIVAPVRYAHLAAQQAQFVKSETSS-G-ELP-RLHMNV--SDSMFF- Nicotiana_attenuata_NaAGO9 R-PGFGSGQKI-RLLTNHFKVGMILDKVQQTY-ALELAGKAYDGEKSLFTI-GAL-PVVIK-YA-A-KIPMYQETVRVLD-IVLRQHAAKRQSFFHD-EPRELGGGVRGFHSSFRATQGLSLNMAS-TTMIVQGPVVDFLAKKMLKNLRIREYKITGLTEKPCKETVYEYFHHRHIPLNYFPCINVGKP-KH-PFIPLELCHLVSLQRYTKAQRASLVEKSRQKPQERAL-KTS-NYADPLL-GSAGISISDQFTQVEGRILPTPKLKGRWN--FNQKQLVELSKLERWAVVNFSARMDLQRGISISEKMLEAVQ-FLLCILPERKNSWKRRNLSDLGIVTQCIAND-QYLTNVLLKINAKLGGMNSFLAMELSPV-LPQISKVPTIIIGMDVSHGPGRA-D-V--PSIAAVVSSRQWPLISRYRAAVRTQ-SPKLEMIDSLYKELLVDFKVKPEHIIIF-RDGVSESQFNQVINTELDQIIEAC-NHLDENWFPKFTVVVAQKNHHTKFFTVIDNAICHPKNNDFYMCAHAGPGTTRPTHYHVLHDEIGFSADDMQELVHSLSYVYQRSTTAISVVAPICYAHLAAAQSQFIKSETSS-S-ALP-RLHRNV--RSSMFF- Nicotiana_benthamiana_NbAGO1.1 R-PGKGSGIRC-IVKANHFFAELVMEQLVKLYRESHLGKRAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPTSGRSFYSP-HLGPLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPIIDFVIKKALRGVKVRKYRISGLTSQATREAVVEYFETYGFVIRHWPCLQVGNT-QR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPQERTV-HHN-AYDDPYA-KEFGIKISEELAQVEARVLPAPWLKGQWN--MMNKKMVNGGTVNNWICVNFSRNSELAQGMNFNERVLKTRD-LLIVILPDNNGSLKRICETELGIVSQCCLSK-QYLANVSLKINVKVGGRNTVLVDALSRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEITKYAGLVSAQ-AHRQELIQDLYKELLISFGQKPQRIIFY-RDGVSEGQFYQVLLFELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADALQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDNGSV-T-PLP-ALKENV--KRVMFY- Nicotiana_benthamiana_NbAGO1.2 R-PGKGSGMRC-IVKANHFFAELVMAQLVKLYQESHLGKRAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPTSGRSFYSR-DLGPLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVIKKALRGVKVRKYRISGLTSQATRESVIEYFETYGFVIQHWPCLQVGNQ-QR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPQGRTV-HHN-AYNDPYA-KEFGIKISDKLAQVEARILPPPRLKGQWN--MMNKKMVNGGTVNNWICINFSRNSELAQGMNFNERVLKTRD-LLVVILPDNNGSLKRICETELGVVSQCCLSK-QYLANVALKINVKVGGRNTVLVDAISRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEITKYAGLVSAQ-AHRQELIQDLYTDLLISFGQKPQRIIFY-RDGVSEGQFYQVLLFELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFTADALQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDGGSV-T-PLP-ALKDNV--KRVMFY- Nicotiana_benthamiana_NbAGO4.1 R-RGLGSGQKI-PILTNHFKVNVVLDRVHETY-DTELAGKAYDGEKSLFTI-GSL-PVEIS-FA-A-KIPMSQEALRVLE-IILRQHAAKRQSFFHN-DPKEVGGGVRGFHSSFRTTQGLSLDIVS-TTMIIQGPVVDFLAKRTLKNLRVQEFKITGLSEKSCRETVYDYFNHRNIDLRYLPCINVGKP-KR-SYFPVELCSLVSLQRYTKAQRSSLVEKSRQKPQERAL-KIN-NYAEPLL-RASGVSISSNFTQVEGRVLPAPKLKGRWN--FNNKRFFDPAKVERWAVVNFSVRRDLTRGISVEEKMFEEIK-FLLCLLPERKNCWKRKNLADYGIVTQCLAND-QYLTNLLLKINAKLGGLNSVLAIEHSPS-IPMVSKVPTMILGMDVSHGPGQS-D-V--PSIAAVVSSRQWPSISRYRASVRTQ-SPKVEMIDNLFKELLLDFKRKPEHIVIF-RDGVSESQFNQVLNIELDQLIEAC-KFLDEKWSPKFVIIVAQKNHHTKFFTIIDNKVCHPRNYDFYLCAHAGMGTTRPTHYHVLLDEVGFSPDDLQDLVHNLSYVYQRSTTAISIVAPVSYAHLAATQGQWMKSETSS-S-QLP-RLQENV--SSSMFF- Nicotiana_benthamiana_NbAGO4.2 R-RGLGNGQKI-QILTNHFKVNVVLDRVHETY-DTELAGKAYDGEKSLFTI-GAL-PVEIS-FA-A-KIPMSQEALRVLD-IILRQHAAKRQSFFHN-DPKDVGGGVRGFHSSFRTTQGLSLNIVS-TTMIIQGPVVDFLAKRMLKNLRVQEFKITGLSDRPCRETVYDYFNHRNIDLRYLPCINVGKP-KR-PYFPIELCNLVSLQRYTKSQRSSLVEKSRQKPQERAL-KIN-KYAEPLL-RACGISISSNFTQVEGRVLSPPKLKGRWN--FNNKRLVDPTKIERWAVVNFSARSDLIKGIMVEEKMFEEVK-FLLCLLPERKNCWKRKNLAEFGIVTQCIAND-QYITNVLLKINAKLGGLNSMLTVEHAPA-IPMVSKVPTIILGMDVSHGPGQS-D-V--PSIAAVVSSRQWPSISRYRASVRTQ-SPKVEMIDNLFKEALLDFKRKPEHIIIF-RDGVSESQFNQVLNIELDQIIEAC-KFLDEKWSPKFTVIIAQKNHHTKFFTIIDNKVCHPRNYDFYLCAHAGMGTTRPTHYHVLHDEIGFSPDDLQELVHNLSYVYQRSTTAISVVAPICYAHLAATQGQWMKSETSS-S-QLP-KLEEKV--SSSMFF- Nicotiana_tabacum_NtAGO1 R-PGKGSGIRC-IVKANHFFAELVMEQLVKLYRESHLGKRAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPTSGRSFYSP-HLGPLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPIIDFVIKKALRGVKVRKYRISGLTSQATREAVVEYFETYGFVIRHLPCLQVGNT-QR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPQERTV-HHN-AYDDPYA-KEFGIKISEKLAQVEARVLPAPWLKGQWN--MMNKKMVNGGTVNNWICVNFSRNSELAQGMNFNERVLKTRD-LLIVILPDNNGSLKRICETELGIVSQCCLSK-QYLANVSLKINVKVGGRNTVLVDALSRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEITKYAGLVSAQ-AHRQELIQDLYKELLISFGQKPQRIIFY-RDGVSEGQFYQVLLFELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADALQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSV-T-PLP-ALKENV--KRVMFY- Oryza_sativa_OsAGO11 R-PGFGTGTSC-RVRANHFVVQLIINELLRSHKKYLDGRRAYDGRKGMFTA-GAL-PVTIK-CA-G-AANLDRFSHKHLD---------------------------------IRILIALNGGEIS-ATTFYKQPVIDFA-------------------------SVVQYFRQYSYSLKYWPCLQAGSD-SR-PYLPMEVCRIVKGQRYSRKQVTRMLRLARETPEERIA-NEN-NYNDYHA-REFGIGVTNQLALVDARVLPAPMLKGQWN--MNNKRMLNGGSINYWACLTFASCKELVRGMQITDAAVRDIE-LLVIVLPDANATIKRLCETELGVITQCCL----------------VGGRNTVLEDALHRR-IPLLTDMPTMIFGADVTHPAGED-S-S--PSIAAVVASMDWPEVSKYKCSVSSQ-SHREEIIADLFTELIESFSYKPGRIIFY-RDGVSEGQFSQVLLSEMDAIRKAC-ASIEEGYLPPVTFVVVQKRHHTRLFTVVDTKICHPSEFDFYLCSHSGIGTSHPTHYYVLFDENNFSADALQTLTYHLCYTYARCTRSVSIVPPVYYAHLAASRRHYLEDHGSS-S-PLP-EIKENV--KQFMFY- Oryza_sativa_OsAGO12 R-PDVGTGRRC-RVRANHFLVQVIINKLVALHKQ-FLDGRVYDGRKSIYTA-GPL-PVTIK-QA-S-KTDLPQDTIQALD-IALRECPTSSRSFFSQ-SFGEIGSGTRGYYQSLRPTQGLSLNIIS-ATAFYKQPVMDFALKKALKGVQIIRYKITGIPSAPMNESVVQYFKQYNYSLKHWPCLQAGSD-SR-PYLPMEVCSILEGQRYSKKQVTNILRMTCERPAQRIV-NTN-SYNDDCA-KEFGIKVANQLAVVDARVLPTPRLKGQWN--MINKRMVNGGCINHWTCLSFASREDLVGGMQMNEGAIRNIQ-LLIVILTEISGSIKRICETEVGVITQCCAGK-QYLENLALKMNVKVGGRNTVLEDALHKK-IPILTDRPTIVFGADVTHPPGED-A-S--PSIAAVVASMDWPEVTKYKCLVSTQ-SHREEIISNLYTELLRSFGQKPSRIIFY-RDGISEGQFSQVLLYEMDAIRKAC-ASLQEGYLPPVTFVVVQKRHHTRLFTVVDTMICHPSEFDFYLCSHSGIGTSRPTHYHVLLDENGFKADTLQTLTYNLSYTYARCTRAVSIVPPAYYAHLGAFRRYYMEDQGSS-S-PLP-EIKENV--KRFMFY- Oryza_sativa_OsAGO13 -----------------------------------------------------------------------PQETI----------------------QFGDIGEGLRGYYQSLRPTQGLSLNIIS-ATSFFKVTVIQFVIKKALRGVRIRRYKITGITPIPMSQTVVQYFDRYNYRLKYWPCLQSGSD-SR-PYLPMEVCKIVEGQRYSKKQVTNILRATCQRPQQRMV-LHN-KYDDRFA-QEFGIK-----------------LKGQWN--MINKKMINGGTVDNWTCLSFS-RGDLIQGMSFNENALRDVQ-LLIVILLEVSGSIKRVCENDLGIVSQCCLNK-QYLENVALKINVKKSQQSSLVL----------------------MSHTPGED-S-A--SSIAAVVASMDWPEITKYRGLVSAQ-SHRQEIIEDLFSEFLIAFGRRPERIIFY-RDGVSEGQFSRVLLHEMDAIRKAC-ASLEEGYLPPVTFVVVQKRHHTRLFTVKDRQICHPTEFYFYLCSHAGIGTSRPTHYHVLYDENHFTADELQTLTNNLCYIYARCTHAVSVVPPAYYSHLAASHHCCIKGSGST-P-ALG-DIKPEM--RKVLFF- Oryza_sativa_OsAGO14 R-PGFGTGERI-VVRANHFLVRVVMSELARLHRESHLGGIAYDGSKALYTA-GKL-PVTIR-RA-G-QADLQQQTIQALD-VVLRESPSLSRSFYST-MFGDIGDGLKGYYQSLRPTQGLSLNIIS-STPFFKISVVEYVVKKALRGVRVSKYKITTITSEPLSQTVIQYFQRYKYRLQYWPCLQSGNP-SN-PYLPMEVCTIVEGQRYSKKQVTGLLRATCQPPQKRMV-QHN-NYADKVV-SDFRINISNQMATMPARVLPAPTLRGQWN--MINKKMVGGAVVQKWTCVNFS-RGELVYGMVFNEAALSNIQ-LLIVILPDVNGYIKRVCETELGIVSQCLKDR-QFLENVSLKINVKAGGRNSVLQRPL----VPGGLENTTIIFGADVTHPSGED-S-S--ASIAAVVASMDWPEITKYKALVSAQ-PPRQEIIQDLFTELLMSFKRKPQRIIFY-RDGVSDGQFLHVLLYEMDAIKKAI-ASLDPAYRPLVTFVVVQKRHHTRLFTVVDTNICHPSEFDFYLCSHAGIGTSRPTHYHVLHDENRFSADQLQMLTYNLCYTYARCTRSVSVVPPAYYAHLAAFRRYYDEDGASS-V-RLP-QIKENV--KDVMFY- Oryza_sativa_OsAGO17 L-SSEGMGESC-IVRTNCFSVHLVIRELVKQQKDSGLGGRAYDGRKRLYTS-GPL-PVTLK-FA-A-KISLSRAALRALD-VVLKELPTAAGSFYSP-NLGQLCKVLRGFHQRIQATQGLQLNIVS-SSVFIKVPVVDYVIKEALEGLKVNTYHVQDLVHQAAS----------NFSIQYLPCLKVAHF-GE-TFLPLEVCKIAEGQCHQKQHMAALLQVARQPPNERTV-HQN-KYEDPHA-KEFGIKIEEKLVSIKSRILPAPWLKGIWN--MMHKKMINGGRVKSWACVNFCWSYDLGFGMVFSESALRTLD-LLIVILPNNNGSVKRICETDIGLISQCCLNK-WYLASVALKINAKMGGRNTVLVDALEMR-LPHVRDTPTIVFGAHVTHPPGKA-N-S--SSIAAVVASQDWPEVTKYAGLISVQ-ACHQESIQGLFKEHLMSFKRKPGRIIFY-RDGVSKGQLPQALMHELGAIKMAC-ASMGPDYNPLVTYVVLQKCRHTRLFTVVDSNICQPNQFDFYLCSHRSTGTKRPRYYHVLWDENDFLAGSFQELTNYLCYTSATCTQSISVVAPVHYARLLSSRRCYIKDSTSH-T-SLL-PIKDNL--KGAMFF- Oryza_sativa_OsAGO18 R-PGFGAGEEC-LVKVNHFFVGLIISKLVTERRHTDFGGRVYDGRANLYTA-GEL-PVAIR-HV-A-PVSLPSQALQLLD-IVLRDMVLAGRSYFSP-GLGELDKGIKGFYQSCRVTQGLSLNIMS-STAFIEGRVLNFVLMRTLKGVKVKKYRIAGFTEQSADVTVKEYFKKYNLKLAFLPCLQVGSK-ER-PYLPMELCNIVPGQRYKNRQVSNLINITNDRPCDRTV-SSN-QYSTERA-DEFGIEVDSYPTTLKARVLKAPMLKGAWN--MKDKKVVNGATIKSWACVNLCEGLQLVRGLDFAKTDLPMRD-LLLVVMTDDKNNVKRICETEIGVLSQCCRNV-QYCANVALKINAKAGGRNSVFLN-VEAS-LPVVSKSPTIIFGADVTHPSFDE-S-T--PSIASVVASADWPEVTKYNSVVRMQ-ASRKEIIQDL--ELLNAFKMEPKQLIFY-RDGVSEGQFQQVVESEIPEIEKAW-KSLYAG-KPRITFIVVQKRHHTRLFTVVDTVICHPREFDFFLCSQAGIGTSRPSHYHVLRDDNNFTADQLQSVTNNLCYLYTSCTRSVSIPPPVYYAHKLAFRRFYLTAGGDP-GWVLP-EIKEEV--KKSMFF- Oryza_sativa_OsAGO1A R-PGKGTGDRC-IVKANHFFAELVIGEIVTQYRQSHLGGRVYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTAARSFYSP-NLGQLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVIKKALRGVKVRKYRISGLTSQATRETVVQYFETYGFNIKHLPCLQVGNQ-QR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPQERTV-HHN-AYQDPYA-QEFGIRIDERLASVEARVLPPPWLKGQWN--MMNKKMVNGGRVNNWTCINFSRHRELAIGMDFSERALKARD-LLIAILPDNNGSLKRICETDLGLVSQCCLSK-QYLANVALKINVKVGGRNTVLVDALTRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEVTKYAGLVSAQ-AHRQELIQDLFKELLISFGQKPQRIIFY-RDGVSEGQFYQVLFYELDAIRKAC-ASLEADYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFTADGLQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSM-A-PLP-DLKENV--KRVMFY- Oryza_sativa_OsAGO1B R-PGKGTGDRC-IVKANHFFAELVMFELVTLYRYSHLGGRAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTTGRSFYSP-NLGQLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVIKKALRGVKVRKYRISGLTSQATRETVVQYFETYGFSIQHLPCLQVGNQ-QR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPQERTV-SHN-AYEDQYA-QEFGIKIDERLASVEARVLPPPRLKGQWN--MMNKKMVNGGRVNNWACINFSRNHELAIGMDFAERALKARD-LLIVILPDNNGSLKRICETDLGLVSQCCLSK-QYLANVALKINVKVGGRNTVLVDALTRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEVTKYAGLVSAQ-AHRQELIQDLFKELLISFGQKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFTADELQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSM-A-PLP-ALKENV--KRVMFY- Oryza_sativa_OsAGO1C R-PGKGTGTRC-MVKANHFFAHLVIKELVNLYKASYLGGRAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPSAGRSFFSP-YLGPLGEGLRGFYQSIRPTQGLSLNIMS-ATAFIELPVIDFVIKKALRGVKVRKYRISGLTIQPTRESVVQYFETYGFAIQHLPCLTV----QR-LYLPMEVCKIVEGQRYSKRQIRALLEETCQHPRDRMV-KHN-AYDDPYA-KEFGIKISDRLASVEARILPAPRLKGQWN--MMNKKMVNGGKVRSWMCVNFARNHELALGMDFAERALKARD-LLIGILPDNNGSLKRVCEIDLGIVSQCCCNK-QILANLALKINVKVGGRNTVLVDAVSRR-IPLVTDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEVTKYAGLVSAQ-AHRQELIEDLYKELLISFGEKPQRIIFY-RDGVSEGQFYQVLLYELNAIRKAC-ASLETNYQPKVTFIVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADALQILTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSSSV-V-PLP-ALKDSV--KRVMFY- Oryza_sativa_OsAGO1D R-PGSGSGTRC-LVKANHFFAQLVMEELVRLHKMSYLGGRAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTAGRSFFSP-DLGSLGEGLRGFYQSIRPTQGLSLNIMS-ATAFFELPVIDFVIKKALRGVKVRKYRISGLTSQATRESVVQYFETYGFAIQHLPCLQVGNQ-QR-PYLPMEVCKIVEGQRYSKRQIRALLEETCQRPHDRMV-NHN-SYEDPYA-KEFGIKISERLALVEARILPAPRLKGQWN--MMNKKMVNGGRVRSWICVNFARNRELARGMDFAERALKARD-LLIGLLPDNNGSLKRICEIDLGLVSQCCCNK-QILANLALKINVKVGGRNTVLVDAVSRR-IPLVTDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEVTKYAGLVSAQ-SHRQELIDDLYNELLISFGQKPQRIIFY-RDGVSEGQFYQVLLHELDAIRKAC-ASLEANYQPQVTFIVVQKRHHTRLFTVVDSKICHPTEFDFFLCSHAGIGTSRPAHYHVLWDENNFTADALQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSM-A-PLP-ALKDSV--KNVMFY- Oryza_sativa_OsAGO2 R-PDGGGKAKV-KLLVNHFIVKYVKDELFKDE-SFRRLSSAYDGKRNLFTC-AEL-PVSVE-FK-K-KLPLPREVLQGLD-VIVREASSWGQGFYSQ-GR-PIGPDVKGTQQTLKCTQGLILCVYS-VMPFRKGPVLDLVLKNELKGQRVQKYIVKGLTDKPASQKLLDYYQQYGKVIEYLPCLDLSKSKDK-QYVPIELCDLLEGQRYPKASDKTLKEMALIPASSRLV-NADDGPRGEIA-QQFGISLDVQMMEVTGRTLPPPSLKCQWN--LTRKRLAEGGVLQCWGVVDFSADDKIVRGVQMNFEELNKAQ-LLFCPMSDQHPGLKLICETQLGIQTQCFLQD-QYMSNLALKINGKIGGSNIQLFGE---S-LPRISGAPYMFIGADVNHPPGNV-E-S--PSIAAVVASVD-QGASKYVPRIRAQ-PHRCEVIQHL--ELIGVFRVKPQRIIYF-RDGVSDGQFDMVLNEELADMEKAI-KT---DYSPTITVIVAKKRHHTRLFTVVDTGVVDPAAYDFYLCSHNGLGTSRPTHYYSLLDEHGFASDDLQKLVYNLCFVFARCTKPVSLATPVYYADLAAYRRLYYESQPPP-S-SFP-ALHEDL--VDNMFF- Oryza_sativa_OsAGO3 RPPGGGGKGEV-KLLVNHFSVDYVKNELFEHE-SLQELSSAYDGERNLYTC-AEL-PVSVK-LK-K-PLPLPRDVMQGLD-VIVREASSFGQGFYPQ-SGSISDSNIKGTQQSLKCTQGLILCVYS-VLPCWKGSVLDLVLNNALKGLCVEKYTVKGLTDKPADQKLIEYYETYKKEIEHLPCLDLSKSKSK-QYVPIEFCNIPEGERYPVATKTTLRKISIKVASSRLVGNAQDGPRGKIA-QRFRISLDAAMMEVTGRILAPPTLECQWN--WKLKKVAHGGTLNCWGVVDFSEGDKVVRGMVMTRDALIEAQ-LLFCPMLNRCHGLKLMCETELGIQTQCFLQD-QYITNLALKINGKIGGSNMQLDPD---S-IPVVSAKDFMFIGADVNHPPGNV-S-KDIPSIAAVVASVD-KGASKYVTRIRAQ-YHRCEMIQNL--ELIGAYKKKPDSIIYF-RDGVSDGQFDMVLNEELADMENKI-MV---GDYPKITVIVAKKRHHTRLFTVVDTDVVDPTAYDFYLCSHKGEGTSRPTHYYSLLDEHGFASDDLQKLVYNLCFVFARCTKPVSLATPVYYADLAAYRRLYYELQPAA-S-ELP-PMHGDL--LNNMFF- Oryza_sativa_OsAGO4A R-SGCGKGQPI-QLLTNHFKVSLVLDKLQQTY-ASELANKAYDGEKSLFTI-GAL-PVELN-FA-A-KIPMTQEAIRVID-IILRQHSAKRQSFFHN-NPSDLGGGVRGFHSSFRATQGLSLNIVS-TTMIVKGPVVDFLAKRALKNLRITEYKIVGLSERNCYESVYEYFKNRGIELRYFPCINVGKP-KR-PYFPIELCSLVPLQRYTKAQRSSLVEKSRQKPEERVL-KRS-NYSEPML-NSCGISIARGFTQVAGRVLQAPKLKGRWN--FNNKRLIKASSIEKWAVVNFSARRDIIKGIKVEDGMIDKMK-FLLCVLAERKNSWKRKCLAEFGIITQCVAND-QYITNVLLKINAKLGGLNSLLQIETSPS-IPLVSKVPTIILGMDVSHGPGQS-D-I--PSIAAVVSSREWPLVSKYRASVRSQ-SPKLEMIDGLFKELLVDFKRKPDQVIIF-RDGVSESQFTQVLNIELDQIIEAC-KFLDENWSPKFTLIVAQKNHHTKFFTVVDNAVCHPRNNDFYMCAHAGMGTTRPTHYHILHDEIGFSADDLQELVHSLSYVYQRSTTAISVVAPICYAHLAAAQSQFIKSETSS-S-ELP-RLHNKV--RSSMFF- Oryza_sativa_OsAGO4B R-PGLGRGQPI-QLLANHYKVSVVIDKLQQTY-RSELSSKAYDGEKSLFTI-GAL-PVELC-FA-A-KIPMSQEALRVLD-IILRQHSAKRQSFFHN-NPNDLGGGVRGFHSSFRGTQGLSLNIVS-TTMIVKGPVIDFLAKRALKNLRISEFKIIGLSDRNCNETVYDYFKNKGIELRYLPCINVGKP-KR-PYFPIELCSLIPLQRYTKAQRSSLVEKSRQKPQERAL-RHS-NYSDPML-RASGISIAQNFTQVEGRVLQPPKLKGRWN--FNNKKLIQTCSVDKWAVVNFSARRDLIRGIQMADDMFEQIK-FLLCLLPERKNCWKRKCLAEFGIVTQCLAND-QYLLNLLLKINAKLGGINSLLQIEASPS-IPLVSKTPTIILGMDVSHGPGQS-D-R--PSIAAVVSSRQWPLISKYRASVHTQ-SPKLEMMSSLFKESLIDFKRKPDHVIVF-RDGVSESQFTQVINIELDQIIEAC-KFLDEKWSPKFTVIVAQKNHHTKFFTVVDKQVCHPRNYDFYMCAHAGMGTTRPTHYHVLHDEIGFSPDDLQELVHSLSYVYQRSTTAISVVAPICYAHLAAAQGTFLKSDASS-S-ELP-RLHEKV--RSSMFF- Oryza_sativa_OsMLE1 R-PGFGAGKKV-MIRANHFLVNVVLNELIKLHGKTSLGGKAYDGRKSLYTA-GSL-PITIR-IA-G-RTDLPQETIQVLD-VVLRESPSWSRSFFST-QFGDIGEGLRGYYQSLRPTQGLSLNIIS-ATSFFKVTVIQFVIKKALRGVRIRRYKITGITPIPMSQTVVQYFDRYNYRLKYWPCLQSGSD-SR-PYLPMEVCKIVEGQRYSKKQVTNILRATCQRPQQRMV-LHN-KYEDRFA-QEFGIKVCNDLVSVPARVLPPPMLKGQWN--MINKKMINGGTVDNWTCLSFS-RGDLIQGMSFNENALRDVQ-LLIVILPEVSGSIKRVCETDLGIVSQCCLNK-QYLENVALKINVKVGGRNTVLERAFIRNGIPFVSEVPTIIFGADVTHPPGED-S-A--SSIAAVVASMDWPEITKYRGLVSAQ-PHRQEIIEDLFSELLIAFGRRPERIIFY-RDGVSEGQFSHVLLHEMDAIRKAC-ASLEEGYLPPVTFVVVQKRHHTRLFTVVDRQICHPTEFDFYLCSHAGIGTSRPTHYHVLYDENHFTADALQSLTNNLCYTYARCTRAVSVVPPAYYAHLAAFRRYYVEDGGST-P-QLP-KIKENV--KDVMFY- Oryza_sativa_OsPNH1 R-PGFGTGARC-VVKANHFLAELIMSELVRLYHDSDLGGRAYDGRKNLYTA-GTL-PVAIK-FA-A-RADLPQEALQVLD-IVLRELANRGRSFYSP-DIRRLGDGLCGFYQSIRPTQGLSLNIMS-STAFIELPVIEFVIKKALRGVKVRKYRISGLTTQPTHESVVEYFEMYGFTIQHLPCLQVGNQ-KK-AYLPMEACKIVEGQRYTKRQITSLLKVTCRRPREQTV-QQN-GYQDPYA-KEFGINISEKLTSVEARVLPAPWLKGQWN--MVNKKVINGCKVNHWACINFSRSQELAQGMEFNEKALKHVE-LLLAILPDNNGSIKRICETDLGLISQCCLSK-QYLANVSLKINVKMGGRNTVLLDAISWR-IPLVSDIPTIIFGADVTHPTGED-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKELLISFGQKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPSEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADEMQTLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRRFYMEENQTT---PLP-AVKEKV--KRVMFY- Oryza_sativa_OsSHL4 R-PDMGGGAEI-PLSANHFLVQFIKKKLVEEN-PSVLSGSAFDGRKNLYSP-VRF-QVNVR-LV-S-KLCGPQDYLHALD-VVLREGAMEGRSLYAR-SMGDIGGGARGFFQRLRPTKGLALNVLS-LSAFHETGIISYLVEKALKNIRVQRYHVHSLTKETTENMVVDYFEHYNHDIQFLPCLQIGR--SK-PYVPMELCVVCEGQKFLGKQTSKILKMGCERPSERVV-KGAFHASDTYA-DQFSLQVSKHMTKLSGRVLLPPKLKRQWS--FLDSHVAEGSKIKSWALISFGGTNQLSNGILLNEGKLKKIQ-LLICVMERRHQGLKRIAETSIGVVTQCCLTS-QFLTNLALKINAKLGGCNIALYSSFPCQ-IPRISEEPVMFMGADVTHPPLDD-S-S--PSVVAVVASMNWPSANKYISRMRSQ-THRKEIIEQL--ELLEEFGKLPSRIIFF-RDGVSETQFYKVLKEEMHAVRTTC-SRYP-GYKPLITFIVVQKRHHTRLFTVVDTVITHPREFDFYLCSHWGTGTSRPTHYHVLWDENNFRSDEVQQLIHNLCYTFARCTRPVSLVPPAYYAHLAAYRRLYLE--------PLP-KLRDNV--KRLMFY- Pelargonium_hortorum_PhAGO4like R-RGLASGQKI-PLLTNHFKVNVVIDRVQETY-DTELAGKAYDGEKSLFTV-GPL-PVEIS-FA-A-KIPMSQEALRVLD-IILRQHAAKRQSFFHN-DAKDLGGGVRGFHSSFRTTQGLSLNVVS-TTMIVQGPVVDFLAKRTLKNLRITEYKITGLSEKPCKETVYDYFNYRKIELRYLPCINVGKP-KR-PYFPLELCSLVSLQRYTKAQRASLVEKSRQKPQERAL-KTS-NYAERML-RSSGISISSNFTQVEGRVLQAPKLKGRWN--FNNKKLVDPTKIEKWAVVNFSARRDLIKGIRVEEKMFEDIQ-FLLCLLPERKNSWKRKNLSEYGIVTQCIAND-QYLTNVLLKINAKLGGLNSMLAIEHSPS-IPMVSKVPTIIVGMDVSHGPGQS-D-V--PSIAAVVSSRQWPSISRYRASVRTQ-SPKVEMIDSLFKELLLDFKRKPDQIIIF-RDGVSESQFNQVLNIELDQIIEAC-KFLDEKWNPKFVVIVAQKNHHTKFFTVIDNKVCHPRNNDFYLCAQAGMGTTRPTHYHVLLDEMGFSADDLQEFVHSLSYVYQRSTTAISVVAPICYAHLAATQGQFMKSETSS-S-QLP-RLQEKV--AHSMFF- Phaseolus_vulgaris_PvAGO1 R-PGKGSGIKC-IVKANHFFAELVMEQLVRLYRESHLGKRAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPTTGRSFYSP-DLGPLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVIKKALRGIKVRKYRISGLTSQATRESVVEYFETYGFVIQHWPCLQVGNT-QR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPVERTV-YHN-AYEDPYA-KEFGIKISEKLAQVEARILPAPWLKGQWN--MMNKKMVNGGTVNNWFCINFSRSYELAQGMAFNEKVLKTRD-LLIVILPDNNGSLKRICETDLGLVSQCCLSK-QYLANVALKINVKVGGRNTVLVDALSRR-IPLVGDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDYPEITKYAGLVCAQ-AHRQELIQDLFKELLISFGQKPQRIIFY-RDGVSEGQFYQVLLFELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADALQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSM-T-PLP-ALKENV--KRVMFY- Phaseolus_vulgaris_PvAGO10a R-PGYGQGTKC-IVKANHFFAELIIAELVRLYKESDLGMRAYDGRKSLYTA-GQL-PVAIK-FV-A-RANLPQEALQILD-IVLRELATKGRSFFSP-DIRRLGEGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVVEFVIKKALRGVKVRKYRVSGLTSQPTRESVVEYFEMYGFTIQYLPCLQVGNQ-KK-AYLPMEACKIVEGQRYTKRQITALLKVTCQRPRDRTI-QQN-AYQDPYA-KEFGIKISEKLASVEARILPAPWLKGQWN--MMNKKMINGMTVNRWACINFSRSNELAQGMEFNEKALKHVE-LLLAILPDNNGSLKRICETDLGLISQCCLTK-QYLANVSLKINVKMGGRNTVLLDAVSCR-IPLVSDIPTIIFGADVTHPNGED-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKDLLVSFGQKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFIVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRRFYMEENGST-G-PLP-DLKENV--KRVMFY- Phaseolus_vulgaris_PvAGO10b R-PGFGQGTKC-LIKANHFLADIIIAELVRVHRHTGLATRVYDGGRNLYTS-GLL-PVLIK-FA-T-HVSMPQEALTVFD-IVLRELAAQGRFLYSP-DVRQLGGGLRGFYQSIRPTQGLSLNIMS-SMAFIELPVIDFVIKKALRGVKVRKYRISGLTSQPTRESVVDYFEMYGFTIKYLPCLQVGSQ-RK-VYLPMEACKIVEGQRYTKGQITSLLKFSCQRPREQTM-QQN-NYNNPYA-KEFGISIDNKLASVEARVLPPPWLKGQWN--MMNKKVINGSTVRYWTCINFSRSQQLVQGMEFSKKALNYVE-LLIVILPDNNGSLKRICETDLGLISQCCLNR-QYLANVALKINVKMGGRNTVLLDALSWR-IPLVSDIPTIIFGADVTHPSGED-S-C--PSIAAVVASQDWPEVTKYAGLVCAQ-PHREELIQDLFRELLLSFGQKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPSYQPPVTFVVVQKRHHTRLFTVVDSKICHPSEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADEIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAYRRFYMEEITKL---PLP-ALKEKV--KNVMFY- Phaseolus_vulgaris_PvAGO4 R-RGLASGTKL-RLLTNHFRVNVVLDRVQETY-NSELNGKAYDGEKTLFTL-GSL-AVEIS-FA-S-KIPLYQEAIRVLD-IILRQHAAKRQSFFHN-DPKDVGGGVRGFHSSFRTTQGLSLNIVS-TTMIVTGPVVDFLAKRTLKNLRIQEYKITGLSDKPCNETVYDYFNHRNIELRYLPCINVGKP-KR-PYFPLELCSLVSLQRYTKAQRSSLVEKSRQKPQERAL-SRS-NYSEPML-RNCGISISSGFTEVEGRVLQAPRLKGRWN--FNQKKLVRPTKIEKWAVVNFSARRDLQKGIAIEEKMLEFVQ-FLLCLLPERKNSWKKRNLADFGVVTQCIAND-QYLTNVLLKINAKLGGLNSLLGVEHAPS-IPVVSKAPTIIIGMDVSHGPGQT-D-I--PSIAAVVSSREWPLISKYRACVRTQ-SPKVEMIDNLFKELLLDFNRKPENIIIF-RDGVSESQFNQVLNIELDQIIEAC-KFLDATWDPKFLVIVAQKNHHTKFFTVIDSKICHPRNYDFYMCAHAGMGTSRPAHYHVLLDEIGFSADDLQELVHSLSYVYQRSTTAISVVAPICYAHLAATQGQFMKSETAS-S-QLP-RLNDNV--SSSMFF- Phaseolus_vulgaris_PvAGO7 R-PDSGGGTVI-SLLANHFLVQFIKQNLVNNN-SAVLSGAAYDGRKNLYSP-VEF-QINIK-LV-S-KINGPQDYLHALD-VVLRENPTEGRSFYSS-SMGDIGGGARGFFQSLRPTQGLALNVFS-VTAFHEIGVIAYLVEKALKNLRVQRYRVYGLTEEATENRLVNYFDHYNYDIQFLPCLQISR--SK-PYLPMELCVICEGQKFLGKQTARILKMGCQRPGERVM-RGNVGPSGNQE-KEFKLQVSREMTKLTGRILFPPKLKRQWN--LLDGHVSEGSTIERWALISFGGTNQLSQGIFLNESKLKRIQ-LLICIMERKHKGLKRIAETSIGVVSQCCLSS-QFLANLALKINAKVGGCTVALYNSLPSQ-LPRLIDEPVIFMGADVTHPPLDD-F-S--PSVAAVVGSMNWPTANKYISRIRSQ-THRQEIIQDL--ELLDDFEKLPSRIIFF-RDGVSETQFYKVLEDELQSIRCAC-TRFP-GYKPSITFAVVQKRHHTRLFTVVDSVITHPNEFDFYLCSHWGVGTSRPTHYHVLWDENQFTSDELQKLVYNLCYTFVRCTKPISLVPPAYYAHLAAYRRLYLELGLFR-S-PLP-KLSENI--KKLMFY- Phaseolus_vulgaris_PvAGO9 R-RDLGSGMKI-QLLTNHFKVNVIMDRVQETY-HSDLNGKAYDGEKSLFTI-GSL-PVEIS-YA-A-KIPMFQEGIRVLD-IILRQHAAKRQSFFHN-DPKDVGGGVRGFHSSFRTTQGLSLNIVS-TTMIITGPVVDFLAKRTLKNLRIQEFKINGLSEFSCQKTVYDYFNVRKIDLRYLPCINVGKP-KR-PYFPIELCELVSLQRYTKAQRASLVEKSRQKPQERAL-RRS-NYSEPLL-RNCGISISTGFTEVEGRVLPAPRLKGRWN--VSNKKFVEPSKVERWAVANFSARRDLIRGILIEEKMFETIQ-FLLCLLPDRKNCWKKKNLADFGIINQCMCND-QYLTNVMLKINAKLGGLNSMLGVEHTPS-LPIVSKAPTLILGMDVSHGPGQT-D-I--PSIAAVVSSRQWPLISKYRACVRTQ-SAKVEMIDNLFKELLLDFRRKPENIIIF-RDGVSESQFNQVLNIELDRIIEAC-KFLDENWEPKFLVIVAQKNHHTRFFTVIDNRICHPRNYDFYLCAHAGMGTSRPTHYHVLLDEIGFSPDQLQELVHSLSYVYQRSTTAISVVAPICYAHLAASQGHFMKSDTTS-S-QMP-PLKENV--RNTMFF- Physcomitrella_patens_PptAGO1 R-PDRGRGLRC-IVKANHFFVELVMEQLVKLYRESHLSSRAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTHGRSFYSP-NLGPLGDGLRGFYQSIRPTQGLSLNIMS-STAFIEKTVMEFIIKKALRGVKVRKYRISGLTHQATNESVTDYFETYGYFIRHLPCLQVGNS-LR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPRDRTV-HHN-AYQDPYA-QEFGIRISNELAQVEARVLPAPRLKGQWN--MMNKKMVNGGIVNYWACINFSRTQELAQGMQFTDRALFQLD-LLIAILPDNNGPLKKQCETVLGVVSQCCLSK-QYLANVALKINVKVGGRNTVLVDALTRK-IPLVSDIPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKELLISFGQKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPDYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFSADSLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMDDTGSV-T-PLP-PLKENV--KRVMFY- Physcomitrella_patens_PptAGO10 R-PDRGRGQWC-IVKANHFFAEPVMEQLVKLYRESHLGTRAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEVLQVLD-IVLRELPTHGRSFYSP-NLGPLGDGLRGFYQSIRPTQGLSLNIMS-STAFIEKTVMEFIIKKALRGVKVRKYRISGLTNQATNESVTDYFETYGYVIRHLPCLQVGNA-QR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPRDRTV-HHN-AYQDPYA-QEFGIRISNELAQVEARVLPAPRLKGQWN--MMNKKMVNGGIVNNWACINFSRNQELAQGMQFTDRALIHLD-LLIAILPDNNGPLKKQCETVLGVVSQCCLSK-QYLANVALKINVKVGGRNTVLVDALSRK-IPLVSDIPTIIFGADVTHPPGED-F-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKELLISFGQKPLRIIFY-RDGVSEGQFYQVLLFELDAIRKAC-ASLEPDYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFSADSLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMDDTGSL-T-PLP-PLKENV--KRVMFY- Physcomitrella_patens_PptAGO5 R-PSKGSGLRC-IVIANHFYAELVMEQLVKLYRESHLGTRAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTHGRYFYSP-DLGPLGDGLRGFYQSIRPTQGLSLNIMS-STAFIEKTVIEFVIKKALRGVKVRKYRISGLTNQATSESVTDYFETYSYTIRHLPCLQVGNT-QR-PYLPMEVCKIVEGQRYSKRQIAALLQVTCQRPRDRTV-HHN-AYQDPYA-QEFGIRISNELAQVEARILPAPRLKGQWN--MMNKKMVNGGIVQHWACVNFSSNLELAQGMQFAEKALYQLD-LLIAILPDNNGSLKKQCETVLGVVSQCCLSK-QYLANVALKINVKVGGRNTVLVDALSRR-IPLVSDKPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-THRQELIADLFKELLISFGQKPLRIIFY-RDGVSEGQFSQVLLHELDAIRRAC-ASLEEGYQPPVTFVVVQKRHHTRLFTVVDSTICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENSFSADSLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMDDTGSA-T-PLP-PLKENV--KRVMFY- Physcomitrella_patens_PptAGOlike1 R-PSFGRGRLT-QLCVNHFKTELIMTKLRDTFGESECGGKAYDGGKSLFTS-GSL-SVKIE-FA-G-KIRMAIDALRVLD-IVLRESASRRDNFFHP-SLGNLGEGVRGYHSSVRPTGGLTLNLMT-MTTMLKILVEEFLANSVLKGVRIRSHKIAGFSPRPIKDLVEQYYDVYSYTLKYLPAIDVGNK-KK-PFLPLELCKIVAGQRYSKSQRTAQIAACKQGPQERAI-TVS-NYSDRII-SEFGLRFENKLASIEGRMLPAPQLEGRWN--FNNKTVRKGVKIDPWAVAVFDPRDQLVEGMMMREWMLMSLV-FILVILSD-KDSFKRFCEMKIGIISQCMVND-QYLGNLALKINLKMGGFNSPLSRR-----MLTCLGESTIIFGMDVSHGPGDL-S-V--PSIAAVVATKNWPEVFHYSTQVRTQ-PPKMEMITGLYEELLLTYNPKPSQIIIY-RDGVSESQFAECLEVEFMAFKRAC-AELEEGYNPGITFIVAQKRHNTRFFTVVDKDVCHPHNFDFFLVSQAGLGTSRPTHYHVLVNENKLGPDDIQMLTNNLCYTFGRCSTSISMAAPAAYAHVVAGRRKLLDGSDTS-S-ELP-ALKIKP--EYSMFF- Physcomitrella_patens_PptAGOlike2 R-PGYGRGRGT-LLGVNYFKTSLIMKKLRETYGNEYFDGKAYDGEKSLFTS-GCL-PVSIE-LA-A-KIRMALDALRVLD-VILREIASRRDNFFHP-SLGDLGDGVRGYHSSVRPTLGLMLNLTT-MTVVLKTLVDEFLAKDMLKNVRIRKYRISGFSDRSIRESVYNYFDTYSRKLKNFPALDLGNS-RK-PYMPIELCKIVSGQRYTKPQRMAQIGASKQAPQERAL-KVC-NYSDKLI-AEFGLQFDNKLASVSGRVLPAPQLDGRWN--FNHKTLKKGVTIAAWAVAVFDPCFQLIEGMVMKETMFNALV-FILAILAE-KDSFKRLCEIRLGIISQCMVND-QFLGNLALKINLKMGGLNSPLSQR-----MLHCLGQSTIIFGMDVTHGPGDV-E-I--PSIAAVVATKNWPEVFHYSTQVKVQ-PARMEMIQGLYEELLMSFNPKPSQIIIY-RDGVSDSMFAKCLEVEFVAFKRAC-AELEAGYNPGITFIVAKKRHGTRFFTVVDKDACHPRNFDFFLISQAGLGTARPTHYTILVNENQLGPDDIQTLTNKLCYTFGRCTSSISMAAPAAYAHILASRRKLMSGSTTS-S-PVP-ILRMKA--DHSMFF- Physcomitrella_patens_PptAGOlike3 R-PSFGKGRPS-KLCMNHFKTSIIMKKLRETYGEAECGGKAYDGENCLFTS-GSL-SVKIE-FA-A-TIRMALDALRVLD-IVLRENASERDNFFHP-ELGDLGEGVRGYHSSIKPTGGLTLNLVT-MTTILKITVEKFLAKSILKGVKVREHKISGFSDRAIRDSVQQYYDVYMYTLRFLPALVSGNK-KK-AFLPLELCKIIAGQRYTKSQRQLQIAACKQSPQERAM-EVS-KYSDKLI-AEFGLKFESSLAGVTGRILRPPQLEGRWN--FNQKELKQGARIDTWAVAIFDGRESLVDGMQMRERMITALV-FILVILPD-KDSFKRFCEMKIGVVSQCMVND-QYLGNLALKINLKMGGFNSPLSPR-----MVSCLGPSTIIFGMDVSHGPGES-S-V--PSIAAVVATKNWPDVFHYSTQVRIQ-PAKTEMIEGLHDECLKAYYRKPTQIIVY-RDGISESQFAECLEVEFTAFKRAC-AELEEGYNPGITFIVAQKRHNTRFFTVVDKDACHPHNYDFFLVSQAGLGTSRPTHYHVLVNENKLSPDDIQGLTNNLCYTFGRCTTSVSMGKPLQ--------RCFLL------S-------------------- Picea_glauca_PgAGO R-PGHGRGRPV-KLLCNHFRVSFVMDKVKEVYGATGLDGKAYDGENSLFTV-GPL-RVEIT-FA-A-KISMAQDALRVLD-IVLRQHASRRQSFFHW-SFAELGGGVRGYHISFRPTQGLSLNMVS-TTMLIKSAVIDFLAKQVLKGVRIMEFKIFGLSEKPCKETVHDYFNTKQTPLQFLPCLDVGRK-KR-PYLPIELCKILPGQRYTKAQRT?LVEQSRQKPDERAM-DVN-NYSDPLL-KACNINVDKQLVRLDGRVLDPPTLKGRWN--FNNKTMVRASKIGDWAIACFNSRRELQQGLVMAERMLSQMQ-FLLCILPERKNSWKRKFLADLGVINQCIAND-QYLTNVALKINAKVGGLNSVLSVEFAHK-IPKISTKPTIIIGMDVSHGPGHA-D-S--PSISAVVSSREWPLISRYRASVRTQ-SPKVEMIEALYKELLVDFERKPQQMIVF-RDGVSESQFDQVLNVELQAIYKAC-NHIEAGYKPKVTLIIAQKNHHTKLFTIVDAQICHPRNFDFYLCPQAGPGTSRPTHYHVLLDENDFSVDDLQILVHALSYVYQRSTTAISSVAPINYAHLAASQQQFLKSETAS-R-ELP-VLHRNV--CNTMFF- Pisum_sativum_PsAGO1 R-PGKGSGKKC-VVKANHFFAELVMEQLVRLYRDSHLGKRAYMAAKA-FIS-GP--SVINL-LP-G-LP--PQEALQVLD-IVLRELPTTGRSFYSP-DLGPLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVIKKALRGIKVRKYRISGLTSQATRESVVEYFETYGFVIQHWPCLQVGNT-QR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPLDRTV-HHN-AYEDPYA-KEFGIKISEKLAQVEARILPAPWLKGQWN--MMNKKMVNGGTVNNWFCVNFSRNDELAHGMAFNEKVLKTRD-LLIVILPDNNGSLKRICETDLGVVSQCCLSK-QYLANVSLKINVKVGGRNTVLVDALSRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEITKYAGLVCAQ-AHRQELIQDLFKELLISFGQKPQRIIFY-RDGVSEGQFYQVLLFELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADALQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSM-T-PLP-ALKENV--KRVMFY- Pisum_sativum_PsAGO2 R-PGKGKGKKC-VVKANHFFAELVMAQLVKLYRDSHLGKRAYDGRKSLYTA-GPL-PVVIK-FA-S-RADLPQEALQGLD-IVLRELPTSGRSFYSP-LLGPLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIEFVIKKALRGIKVRRYRISGLTSQTTRESVVEYFETYGFVIQHWPCLQVGNP-QR-PYLPMEVCKIVEGQRYSRRQITALLKVTCQRPPDRTV-RHN-AYEDPYA-KEFGIKISDKLA-------------GQW-----NKKMVNGGTVNNWFCVNFSRSCELANGMAFNEKVLRRRD-LLIVILPDNNGSLKRICETDLGVVSQCCLNK-QYLANVSLKINVKVGGRNTVLVDALSRR-IPIVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEITKYAGLVCAQ-AHRQELIQDLFKELLISFGQKPQRIIFY-RDGVSEGQFYQVLLFELDAIRKAC-ASLEPNYQPTVTFVVVQKRHHTRLFTVVDSNICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFSADELQSLSNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSI-A-PLP-ELKENV--KRVMFY- Populus_trichocarpa_PtAGO1 R-PGKGSGIRC-IVKANHFFAELVMEQLVKLYRESHLGKRAYDGRKSLYTA-GAL-PVTIK-LA-A-RADLPQEALQVLD-IVLRELPTAGRSFYSP-DLGSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVIKKALRGVKVRKYRISGLTSQATRESVVEYFETYGFVIQHWPCLQVGNQ-QR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPQERTV-YHN-AYNDPYA-KEFGIKISDKLASVEARILPPPWLKGQWN--MMNKKMVNGGRVNNWICVNFSRNYELAQGMDFAERVLKNRD-LLIVILPDNNGSLKRICETDLGLVSQCCLSK-QYLANVALKINVKVGGRNTVLVDAISRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKELLISFGQKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFTADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSESI-A-PLP-ALKENV--KRVMFY- Populus_trichocarpa_PtAGO10 R-PGYGQGTKC-IVKANHFLAELIMAELVRLYKDSDLGMRAYDGRKSLYTA-GEL-PVVIK-FV-A-RANMPQEALQILD-IVLRELSSKGRSFFSP-DIRRLGDGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIEFVIKKGLRGVKVRKYRVSGLTSQPTRESVVEYFEMYGFTIQHLPCLQVGNQ-KK-AYLPMEACKIVEGQRYTKRQITALLRVTCQRPRDRTV-QHN-AYQDPYA-KEFGIKISEKLASVEARILPAPWLKGQWN--MMNKKMINGMTVSRWACINFSRSNELAQGMEFNEKALKHVE-LLLAILPDNNGSLKRICETDLGLITQCCLSK-QYLANLSLKINVKMGGRNTVLLDAISCR-IPLVSDIPTIIFGADVTHPNGED-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKDLLISFGQKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFIVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRRFYTEENGSA-G-PLP-ALKENV--KRVMFY- Populus_trichocarpa_PtAGO4a R-RGYGAGQRI-QLLTNHFKVAVVMDKVQETY-DSELEGKAYDGEKTLFTT-GSL-PVQIS-YA-T-KIPVFQEAVRVLD-IVLRQNAARRQSFFHN-NPRELGGGVRGFHSSFRAAQGLSLNIVS-TTMIVKGPVVDFLAKRMLKNLRITEYKITGLTEKSCRETVYDYFNHRNMGLQYFPCINVGKP-KR-PYFPLELCNLVSLQRYTKAQRASLVEKSRQKPQERAL-RSS-NYADPML-RSSGISISAQFTQVEGRVLSAPRLKGRWN--FNNKKLVDPVKIEKWAIVNFSARNNLIKGISISERMFEAIQ-FLLCILPERKNSWKRKNLSDLGIVTQCIAND-QYLTNVLLKINAKLGGMNSLLSIEHAPS-IPLVSKLPTLILGMDVSHGPGHS-D-V--PSIAAVVSSRHWPLISRYRASVRTQ-SQKVEMIANLFKESLLDFKRKPDQIIIF-RDGVSESQFIQVLNIELEQIIEAC-KFLDENWCPKFMVIVAQKNHHTKFFTVIDNKVCHPRNNDFYMCAHAGMGTTRPTHYHVLHDELGFSADDLQELVHSLSYVYQRSTTAISVVAPICYAHLAASQTQFIKSDTSS-S-ELP-RLHNNV--SSSMFF- Populus_trichocarpa_PtAGO4b R-RGFGSGQKI-QLLSNHFKVSILIDKVHETY-GSDLAGKAYDGEKSLFTI-GAL-PVEMS-FA-A-KIPMSQEALRVLD-IILRQHAAKRQSFFHD-DPKDLGGGVRGFHSSFRTSQGLSLNIGS-TTTIIQGPLIDFLAKRTLKNLRIQEYRITGLSENTCKETVYHYFNHRSIDLRYLPCINVGKP-KR-PYIPVELCSLLPLQRYIKAQRSQLVEKSRQKPQEKVM-KSN-NYAEQML-RSCGITISSQFTQVQGRVLTAPKLKGRWN--FNHKKFFEPSKIENWAVVNFSARRDLIRGILISEKMFEQIR-FLVCLLPDRKNSWKRKNLAEYGIFNQCLANE-QYILNVLLKINAKLGGLNSLLAMEQSRN-IPFVSKVPTIIFGMDVSHGPGQS-D-M--PSIAAVVSSRNWPLLSRYRASVRSQ-SPKVEMVDSLFTELLLDYQTKPAQIIIF-RDGVSESQFNQVLNIELDQIIEAC-KFLDESWSPKFTVIVAQKNHHTKFFTVIDNAVCHPQSYDFYMCAHAGMGTTRPTHYHVLLDEIGFSADDLQELIHSLSYVYQRSTTAISVVAPVRYAHLAATQSQFLKSETSS-S-ELP-ELHRNV--CSSMFF- Populus_trichocarpa_PtAGO6 R-RGVGTGRHI-SLLTNHFKVSVLIDRLYQTY-SSEFAGKAYDGEKSLYTV-GPL-PVETS-YA-A-KIPLTQDALRVLD-IILRQQAANRQSFFHD-DSRDVGGGVKGFHSSFRTTQGLSLNMVS-TTMILTGPVIDFLARRMLKNLRVMEFKIIGLSEKPCNQTVYDYFKHCGIQLGYLPCLDVGKP-KR-PYLPLELCSLISLQRYKKAQRASLVEKSRQKPQERAM-RSY-CYEDPVL-SSCGISIEKQMTQVDGRILETPKLKVRWN--FNNKTLLNPTSISKWAIVNFSARRELINGINIEERMFELIE-FILCVLAERKNSWKKTSLSDFGIVTQCISND-QYLTNVLLKINSKLGGINSLLAIEHSSH-IPLIMDTPTMILGMDVSHGPGRS-D-M--PSVAAVVGSRCWPLISRYRASVRTQ-SPKVEMIDALYKELLVDFGHKPKQIIVF-RDGVSESQFNQVLNIELEQIIKAY-QHLGEVDIPKFTVIVAQKNHHTKLFTVVDTKIVHPRNYDFYMCAHAGMGTSRPAHYHVLLDEIGFSPDELLNLVHSLSYVYQRSTTAVSIVAPICYAHLAAAQGQFMKSETSS-G-ELP-RLHENV--EGSMFF- Populus_trichocarpa_PtAGO7 R-PDSGGGSVI-TLLANHFPVQFIKQKLVKEN-SAVLSGAAYDGRKSLYSP-VEF-QINIK-LV-S-KLDGPQDYLHALD-VVLRESPMEGRSLYSS-SMGEIGGGARGFFQSLRPTQGLALNVFS-VTAFHEIGVIPYLVEKALKNIRIQRYRVFGLTEEATENRLLNYFDHYNYDIQFLPCLQISR--SK-PYLPMELCMICEGQKFLGKQTARILKMGCQRPKERVM-RGSVGPSGSQG-REFKLHISREMTRLSGRILQPPKLRCQWN--LLDSHVFEGTRIQRWALISFGGTNQLSQGIFLNESKLKKIQ-LLICVMEKKHKGLKRIAETSVGVVTQCCLSS-QFLANLALKINAKVGGCTVALYNSLPSQ-IPRLSNEPVIFMGADVTHPPLDD-I-S--PSVAAVVGSMNWPAANKYVSRMRSQ-THRQEIIQDL--ELLDDFNELPKRIIFF-RDGVSETQFYKVLKEELQAIREAC-SRFP-GYRPPITFAVVQKRHHTRLFTVVDTVITHPREFDFYLCSHWGVGTSRPTHYHVLWDENQFTSDELQKLVYNLCYTFVRCTKPVSLVPPAYYAHLAAYRRLYLEMASIR-N-PLP-KLSENL--KKLMFY- Populus_trichocarpa_PtAGOlike1 R-PDHGTGSRC-LIRANHFLVELIMRELLAS-NSTHFQSRAYDGRKGFYTA-GPL-TVTIR-LA-S-KTDLPHDTIQVLD-VVLREPPSNGRSFFTA-GLGEIGNGIKGFYQSLRPTQGMSLNIVS-VAAFYEILAVDFVLKKALRGVRVKRYKITGISASATNQSVVQYFEKYNIRLRFWPALQSGND-SR-PFLPMECCKIIEGQRYSKKQVTALLREACRRPVERIV-HFN-DVQDDLA-KEFGVSVKKELTCIDARVLPPPVLKGQWN--MINAKLFNGATVNFWMCVNFS-SRALVGGMVINEKTLAEVQ-ILIIILPDVSGSIKRVCETELGIVSQCCQSP-QYLENVALKINVKAGGRNTVLEDALNRR-IPLLSDTPTIIFGADVTHPPGED-S-S--PSIAAIVASMDWPEVTTYRGLVSAQ-KHRQEIIQDC--ELMIAFNQKPSRIIFY-RDGVSEGQFSQVLLYEMDAIRKAC-ASLEPNYLPPVTFIVVQKRHHTRLFTVVDTKICHPSEHDFYLCSHAGIGTSRPVHYHVLCDMNKFTADCLQMLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRRYYIEDSGGG-G-PLP-AISPNV--KNVMFY- Populus_trichocarpa_PtAGOlike2 R-PQLGRGRKC-TIRANHFVVEVVISQLVRSYRESHLGNRAYDGRKSLYTA-GAL-PVAIK-YA-S-KVDMPQETIQILD-IVLRASPSEGRSFFSL-DLGELGNGIRGYYQSLRPTQGLSLNIVS-ARSFYEILVTEFVVKRALRGIKVRSFKVTGISNLPVDKSVHQYFDRYNIGLKYLPPLQAGTD-AK-PYLPMELCKIAGGQRYTKKQVTALLRATCQRPSARAN-NLS-STLNVLVRNEFGIQVKEELTSVDARVLPPPMLKGQWN--MINKKMVNGGKIDFWTCVNFSTKWQLMDGMEFHEKALHDVQ-LLIIILPDFSGSIKRICETELGIVSQCCQSK-QYLENVALKINVKAGGRNTVLNDAIQRR-IPNVTDLPTIIFGADVTHPPGED-S-S--PSIAAVVASMDWPEVTKYRGLVSAQ-AHREEIIQDLYKELFIAFGQKPHRIIFY-RDGVSEGQFSQVLLHEMQAIREAC-GTLEEGYCPPVTFVVVQKRHHTRFFTVVDTKICHPTEFDFYLNSHAGIGTSRPTHYHVLFDENNFTADGLQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRYYIEDSGST-G-SLP-VVKENV--KDVMFY- Populus_trichocarpa_PtAGOlike3 R-PDYGKGKKC-VIRANHFVVEVVISQLVRSYRESHLGNRAYDGRKSLYTA-GAL-PVAIK-YA-S-KVDMPQETIQILD-IVLRASPSEGRSFFSP-DLGDLGDGIRGYYQSLRPTQGLSFNIVS-ARSFYEILVTEFVVKRALRGIKVKSYKVTGISNLPVNKSVYQYFERYNIGLKYLPPLQAGTD-AK-PYLPMELCQIAGGQRYTKKQVTALLRATCQRPSARMV-RQN-DYKNALVRDEFGIQVKEELTLVDARVLPPPMLKGQWN--MIDKKMVNGGRIDFWTCLNFSTRWQLMDGMEFNEKALHDVQ-LLIIILPDVTGSIKRVCETELGIVSQCCQSK-QYMENVALKINVKAGGRNTVLNDAFHRR-IPLLTDVPTIVFGADVTHPAGED-A-G--PSIAAVVASMDWPEVTKYRGLVSAQ-AHREEIIEDLYKELLIAFGQKPFRIIFY-RDGVSEGQFSQVLLHEMQAIRQAC-GSLEEGYCPRVTFVVVQKRHHTRFFTVVDTTICHPTEFDFYLNSHAGIGTSRPTHYHVLFDENNFSSDGLQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRYYIEDAGSS-G-PLP-VIKENV--KDVMFY- Prunus_persica_PprAGO10 R-PGFGQGIKC-IVKANHFFAELIMAELVRLYRESDLGMRAYDGRKSLYTA-GEL-PVVIK-FV-A-RANMPQEALQILD-IVLRELSNKGRSFFSP-DIRRLGEGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIEFVIKKALRGVKVRKYRVSGLTSQPTRESVIEYFEMYGFTIQQLPCLQVGNQ-KK-AYLPMEACKIVEGQRYTKRQITALLKVTCQRPRDRTV-QHN-AYQDPYA-KEFGIKISEKLASVEARILPAPWLKGQWN--MMNKKMINGMTVSRWACINFSRSNELAQGMEFNEKALKHVE-LLLAILPDNNGSIKRICETDLGLISQCCLSK-QYLANVSLKINVKMGGRNTVLLDAISCR-IPLVSDIPTIIFGADVTHPNGED-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKDLLVSFGQKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFIVVQKRHHTRLFTVVDTKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRRFYMEENGST---PLP-ALKENV--KRVMFY- Prunus_persica_PprAGO1a R-PGKGSGIRC-TVKANHFFAELVMEQLVKLYRESHLGKRAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTSGRSFYAP-DLGSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIEFVIKKALRGVKVRKYRISGLTSQATRESVVEYFETYGFVIQHWPCLQVGNQ-QR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPHDRTV-RHN-AYEDPYA-KEFGIKISENLAQVEARILPPPWLKGQWN--MMNKKMVNGGKVNNWICINFSRNSELAQGMAFNEKVLKTRD-LLVVILPDNNGSLKRICETDLGLVSQCCLSK-QYLANVALKINVKVGGRNTVLVDALSRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEITKYAGLVCAQ-AHRQELIQDLFKELLISFGQKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFTADALQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSM-T-PLP-ALKENV--KRVMFY- Prunus_persica_PprAGO1b R-PGRGTGIKC-IVKANHFFAELVMKRLVDLYRESHLGNRAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTAGRSFYSP-DLGSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIEFVIKKALRGIKVRKYRISGLTSQATRESVVEYFETYGFIIKHLPCLQVGNQ-QR-SYLPMEVCKIVEGQRYSRRQITALLKVTCQRPHERTV-RQN-AYADPYA-QEFGIKISENLTLVEARILPAPRLKGQWN--MMNKKMVNGGTVNNWMCINFSWNHELAQGMAFNERALKTRE-LLIAILPDNNGSLKRICETDLGLVSQCCLNKQQYLANVTLKINVKVGGRNTVLVDALSRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEVTKYAGLVSAQ-AHRQELIQDLFKELLISFGQKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPDYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFSADGLQTLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRRFYLEEGGSV-T-PLP-ALKENV--KRVMFY- Prunus_persica_PprAGO4a R-RGLGTGTKI-PLVTNHFKVNVIIDRVHETY-HSELGGKAYDGEKSLFTV-GSL-PVEIS-YA-A-KIPMSQEALRVLD-IILRQHASKRQSFFHN-DPKDVGGGVRGFHSSFRTTQGLSLNIVS-TTMIIQGPVVDFLAKRTLKNLRVLEYKITGLSEKPCRETVYDYFNHRNIQLRYLPCINVGKP-KR-PYIPLELCSLVSLQRYTKAQRASLVEKSRQKPQERAL-KIN-NYAEPML-RSCGVSISSGFTQVEGRVLPAPRLKGRWN--FNNKKLVKPTKIEKWAVVNFSARRDLIKGISIEERMFEDIQ-FLLCLLPERKNSWKRKNLAEYGIVTQCIAND-QYLTNVLLKINAKLGGLNSLLAVEYSPS-IPVVSKAPTIILGMDVSHGPGQS-D-V--PSIAAVVSSRQWPLISRYRASVRTQ-SPKVEMIDSLYKELLLDFKQKPDQIIIF-RDGVSESQFNQVLNIELDQIIEAC-KFLDENWNPKFVVIIAQKNHHTKFFTIIDNKVCHPRNNDFYLCAQAGMGTTRPTHYHVLLDEVGFSADDLQELVHSLSYVYQRSTTAISVVAPVCYAHLAATQGQFMKSETSS-S-QLP-RLKENV--SSSMFF- Prunus_persica_PprAGO4b R-PGIGSGQRI-PLLTNHFKVAVVLDKVKETY-GSELEHKAYDGEKSLFTV-GPL-PVQVN-FA-T-KIPMFQEAVRVLD-IILRQNAAKRQSFFHN-NPRELGAGVRGFHSSFRATQGLSLNMVS-TTMIVKGPVLNFLAKRMLKNLRIMEYKITGLSDKPCKETVSNYFEYKHLPVRDFPCINVGKP-KS-PYFPLELCNLVSLQRYTKAQRASLVEKSRQKPQERAL-KTS-KYADLML-RSSGISIGADFVQVEGRVLSAPKLKGRWN--FNNKKLIQPVKIERWAICNFSARNNMLKGIVINDKMIEYIQ-LLLCILPERKNSWKRRNLSELGIVTQCIAND-QYITNVLLKINAKLGGMNSLLQVEHSPS-IPLVSKCPTLILGMDVSHGPGRS-D-V--PSIAAVVSSRNWPLISRYRAAVRTQ-SPKVEMIASLFKELLLDFSRKPDQIIIF-RDGVSESQFNQVLNLELDQIIQAC-KFLDESWSPKFMVIVAQKNHHTKFFTIIDNKVCHPKNNDFYLCSHAGMGTTRPTHYHVLYDELGFSADDLQELVHSLSYVYQRSTTAISVVAPICYAHLAAAQSQFIKSETSS-S-ELP-RLHANV--INSMFF- Prunus_persica_PprAGO5 R-PGFGTGTRI-QVRANHFLVEVVIKQLVHLYKDSHLGRRAYDGMKSIYTA-GPL-PVAVK-LA-N-KPDLPQEAIQVLD-VVLRAAPSDGRSFFAT-ELGELGDGLRGFYQSLRPTQGLSLNIVS-ARSFYEILVTEFVVKKALKGVKVRSYRITGVSTEPLSQSVVQYYEKYNIVLRNMPALQAGSD-SN-PYLPMELCSIVAGQRYSRKQVTALLRATCQRPHERMV-KQS-NFGDQLIKDEFGMQVREDMALVDARVLPPPLLKGQWN--MINKKMVNGGKVDFWAFVNFS-GEDLVNGVDFHEKVLIDIQ-LLIIILPDVTGSVKRICETELGIVSQCCQSK-QYLENLALKINVKVGGRNTVLNDAIFRR-IPLVTDIPTIIIGADVTHPPGED-S-S--PSIAAVVASMDWPEVSKYRGIVSAQ-AHREEIIQDLYSEHFRAFGRKPERIIFY-RDGVSEGQFSQVLLYEMDAIRKAC-ASLEEGYLPPVTFVVVQKRHHTRLFTVVDTKICHPTEFDFFLNSHAGIGTSRPAHYHVLFDENRFTADQLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRYYIEDVAST-T-ALP-QIKENV--KDVMFY- Prunus_persica_PprAGO7 R-PDSGGGTVI-SLLANHFLVQFIKQTLVEDN-SALLSGAAYDGRKNLYSP-VEF-KINIK-LV-S-KIDGPQDYLHALD-VVLREAPLEGRSLYSS-SMGDIGGGARGFFQSLRPTQGLALNVFS-VTAFHEVGVISYLVERALKNIRVQRYRVFGLTEEATENRLVTYFDHYNYDIQFLPCLQISR--SK-PYLPMELCMICEGQKFLGKQTARILKMGCQRPKERVM-RGPVGPSGIQE-REFKLHVSREMTRLKGRVLQPPKLKRQWN--LLGSHVFEGTRIERWALISFGGTHQLSQGIFLNESKLKRIQ-LLICVMERKHKGLKRIADTSVGVLSQCCLGS-QFLANLALKINAKVGGCTVSLYNSLPSQ-IPRLTDEPVIFMGADVTHPPLDD-F-S--PSVAAVVGSMNWPAANKYVSRMRSQ-THRQEIIQDL--ELLDEFGKLPKRIVFF-RDGVSETQFYKVLQEELQAIKGAC-SKFP-GFAPPITFAVVQKRHHTRLFTVVDTVITHPKEFDFYLCSHWGVGTSRPTHYHILWDENQFTSDELQKLVNILCYTYVRCTKPVSLVPPAYYAHLAAYRRLYLETAYTR-S-ELP-KLSENV--RKLMFY- Ricinus_communis_RcAGO1 R-PGKGSGIRC-IVKANHFFAELVMEQLVKLYRESHLGKRAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPTTGRSFYSP-DLGPLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVIKKALRGVKVRKYRISGLTSQATRESVVEYFETYGFVIQHWPCLQVGNQ-QR-PYLPMEVCKVVEGQRYSKRQITALLKVTCQRPQERTV-HHN-AYNDPYA-KEFGIKISEKLASVEARILPAPWLKGQWN--MMNKKMVNGGTVNNWICINFSRNYELAQGMAFNEKVLKTRD-LLIVILPDNNGSLKRICETDLGLVSQCCLNK-QYLANVALKINVKVGGRNTVLVDALSRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLFKELLISFGQKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFTADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSM-T-PLP-ALKENV--KRVMFY- Ricinus_communis_RcAGO10a R-PGYGQGTKC-IVKANHFFAELIMAELVRLYKESDLGMRAYDGRKSLYTS-GEL-PVVIK-FV-A-RANMPQEALQILD-IVLRELSTRGRSFFSP-DIRRLGDGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIELVIKKALRGVKVRKYRVSGLTSQPTRESVVEYFEMYGFTIQHLPCLQVGNQ-KK-AYLPMEACKIVEGQRYTKRQITALLKVTCQRPRDRTV-QHN-AYQDPYA-KEFGIKISEKLASVEARILPAPWLKGQWN--MMNKKMINGMTVSRWACINFSRSSELAQGMEFNEKALKHVE-LLLAILPDNNGTLKRICETDLGLISQCCLSK-QYLANVSLKINVKMGGRNTVLLDAISCR-IPLVSDIPTIIFGADVTHPNGED-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKDLLVSFGQKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFIVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRRFYMEDNGST---PLP-ALKENV--KRVMFY- Ricinus_communis_RcAGO10b R-PGHGQGTKC-IVKANHFLAQMIMTQLVKMHRETDLGTRVYDGGRNLYTA-RSL-PVTIK-FE-A-LAGMPQEAITVID-IVLRELAAQGRSFYSP-DIKQLEGGLRGFYQSIRPTQGLSLNIMS-ATAFIELLVIEFVVKKALRGVKVRKYRISGLTTQPTRESVVEYFEMYDYTIQYLPCLQVGNQ-RK-VYLPMEACKIVRGQRYTKGQITSLLKVSCQRPRDQTI-HQN-GYHDPYA-KEFGISIDSKLASIDARVLPAPWLKGQWN--MMNKKVINGSIVRYWACINFSRSQQLVQGMDFNKKALKYVE-LLIAILPDSNGSLKRICETDLGLISQCCLNR-QYLANVSLKINVKMGGRNTVLLDAISWR-IPLVSDIPTIIFGADVTHPSGED-I-S--PSIAAVVASQDWPEVTKYAGLVCAQ-PHRQELIQDLFKELLLSFGQKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPSYQPPVTFVIVQKRHHTRLFTVVDTKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADEIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAYRRFYMEENPKI---PLP-ALKEKV--KNVMFY- Ricinus_communis_RcAGO4a R-RGLGSGQKI-SLLTNHFKVNVVIDRVHETY-DSEMGGKAYDGEKSLFTV-GAL-PVEIS-FA-A-KIPMSQEAIRVLD-IILRQHAAKRQNFFHN-DPKDVGGGVRGFHSSFRTTQGLSLNIVS-TTMIIQGPVVDFLAKRTLKNLRIQEYKITGLSEMPCKETVYDYFNHRRIELRYLPCINVGKP-KR-PFIPIELCSLVSLQRYTKAQRASLVEKSRQKPQERAL-KSS-NYAEPML-RSCGVSISTSFVQVDGRQLQAPKLKGRWN--FNNKKLVDPSKIERWAVVNFSARRDLTKGIPIEEKMFDSIK-FLLCLLPERKNSWKKKNLSDFGIVTQCIAND-QYLTNVLLKINAKLGGLNSMLAVEHSPS-IPLVSKVPTIIIGMDVSHGPGHS-D-V--PSIAAVVSSRQWPLISRYRACVRTQ-SPKVEMIDSLYKELLLDFKRKPEQIIIF-RDGVSESQFNQVLNIELNQIIEAC-KHLDEKWNPKFVVIIAQKNHHTKFFTVIDNKVCHPRNNDFYLCAHAGMGTTRPTHYHVLLDEVGFSADELQELVHSLSYVYQRSTTAISVVAPVCYAHLAATQGQFMKSETSS-S-QMP-KLSDKV--SSSMFF- Ricinus_communis_RcAGO4b R-RGNGSGQRI-ELLTNHFKVGVVIDKVRETY-DSDLAGKAYDGEKSLFTV-GSL-PVEIS-FA-A-KIPMSQEAIRVLD-IVLRQHAAKRQSFFHD-DSRDLDGGVRGFHSSFRVSQGLSLNIGS-TTTIIQGPLIDFLAKRTLKNLRIQEYRITGLSENLCKDTVYEYFNHRNIDLRYLPCINVGRP-KR-PFFPIELCSLLPLQRYTKAQRSKLVESSRQKPQEKVM-KSN-NYADPIL-RSCGITISSQFTQLEGRVLTAPRLKARWT--FNNKKFAEPARIENWAVVNFSARRDLCRGIMISEKMFEQIR-FLLSIFPDRKNSWKRKNLAEFGIFNQCLCSE-MYVTNVLMKINAKLGGLNTFLAVEQSRN-VPFVSKVPTIIFGMDVSHGPGQS-D-V--PSIAAVVSSRNWPLLSRYRASVHSQ-SPKVEMIDSLFKELLLDFQTKPAQIIIF-RDGVSESQFNQVLNIELNQIIEAC-KFLDESWSPKFTVIVAQKNHHTKFFTVVDNGVCHPQSNDFYMCAHAGMGTTRPTHYHVLLDEIGFSADDLQELIHSLSYVYQRSTSAVSVVAPVRYAHLAATQRLFMKSETSS-S-ELP-VLHQKV--RSSMFF- Ricinus_communis_RcAGO5 R-PGYGSGMKC-VVKANHFLVDVVISQLIRMFRQSHLGNRAYDGRKSLYTA-GPL-PVAIK-FA-S-KPDIPQETIQVLD-IVLRETPSEGRSFFSP-DLGELGDGIRGYYQSLRPTQGLSLNIVS-ARSFYEIIVTDFVVKKALKSVKVKSYKVTGISNKPLNQSVVQYFEKYNIGLKYLPALQAGSD-AK-PYLPMELCKIVDGQRYSKKQVTALLRATCQRPHERMV-KRN-SYQDVLVRDEFGIQVKEELTFVDARVLPAPMLNGQWN--MINKKMVNGGSVNFWTCVNFSLNRQLIQGMAFNGKTLNDIQ-LLIIILPDISGSIKRVCETELGIVSQCCQSK-QYFENVALKINVKVGGRNTVLNDAVQRR-IPLVTDCPTIIFGADVTHPPGED-S-S--PSIAAVVASMDWPEVTKYRGIVSAQ-AHREEIIQDLYKELFVAFGMKPKRIIFY-RDGVSEGQFSQVLLYEMDAIRKAC-ASLEEGYLPPVTFVVVQKRHHTRLFTVIDTKICHQREFDFYLNSHAGIGTSRPTHYHVLYDENHFTADNLQVLTNNLCYTFARCTRSVSIVPPAYYAHLAAFRRYYIEDGGST-S-PLP-VIKDNV--KDVMFY- Ricinus_communis_RcAGO6 R-QGFGNGHRI-PLLSNHFKVSILIERLYQTY-YTDLGDTAYDGEKTLYTV-GPL-PVAIS-YA-A-KIPLTQDALRVLD-IILRQQAAN----------------------------------VS-TTMILTGPVIDFLAKRMLKNLRIMEFKIRGLSEKPCNQTVYEYFRHCGIELTFLPCLDVGKP-KR-PYLPIELCSLVSLQRYTKAQRASLVEKSRQKPLDRAV-RNY-RYDNPML-SVCGISIEKQLTQVEGRVLETPKLKGRWN--FNNKTLWKSTTIERWALVNFSARRDLVNGIQIEEKMFEQIQ-FILCVLPERKNSWKKKCLSDFGIVTQCISND-QYLTNVLLKINSKLGGINSLLEIEHSKQ-IRLIMDTPTMILGMDVSHGRGCS-D-I--PSVAAVVGSRYWPLISRYRACVRTQ-SPKVEMIDALFKELLVDFGCKPKQIILF-RDGVSESQFNQVLNIEVEQIKQAY-QHLGEAETPKFTVIIAQKNHHTKLFTVVDTKIVHPRNYDFYMCAHAGMGTSRPAHYIVLLNEIGFSPDDLQNLIHSLSYVYQRSTTAISIVAPVCYAHLAAQQGQFMKSETSS-G-ELP-RLHKDV--AGSMFF- Ricinus_communis_RcAGO7 R-PDSGGGPVI-TLLANHFLVQFIKQKLVDEN-SAVLSGAAYDGRKNLYSP-VEF-QLNIK-LV-S-KLDGPQDYLHALD-VVLRESPMEGRSFYSS-SMGEIGGGARGFFQSLRPTQGLALNVFS-VTAFHEIGVIAYLVEKALKNIRVQRYRVYGLTEQATENRLLSYFDHYNYDIKFLPCLQISR--SK-PYLPMELCMICEGQKFLGKQTARILKMGCQRPKERVM-RGSVGPSGNKD-REFKLHVSREMTKLKGRILQPPKLRRQWN--LLDSHVLEGTRIERWALMSFGGTNQLSQGIFLNESKLKKIQ-LLICIMEKRHKGLKRIAETSVGVVSQCCLSS-QFLANLALKINAKVGGCTVALFNSLPSQ-IPRLSDDPVIFMGADVTHPPLDD-F-S--PSVAAVVGSMNWPAANKYASRMRSQ-THRQEIIQDL--ELLDDFGKLPKRIIFF-RDGVSETQFHKVLQEELQAIREAC-SRFP-GYRPPITFAVVQKRHHTRLFTVVDTVITHPKEFDFYLCSHWGVGTSRPTHYHVLWDENQFTSDELQKLVYNLCYTFVRCTKPVSLVPPAYYAHLAAYRRLYLEMTSAR-N-PLP-KLSENV--KNLMFY- Selaginella_moellendorfii_SmAGO10 R-PGRGQGVKC-IVKVNHFFAELVMEQLVKLHRDSSLGHRVYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTHGRSFYSP-DLGPLGDGLRGFYQSIRPTQGLSLNIMS-STAFIELPVVDFVIKKALRGVKVRKYRISGLTSQPTQESVMEYFDTYHYTIRSLPCLQVGNQ-ER-PYLPMEVCKIVEGQRYTKRQVTALLKVTCQRPRERTV-YHN-AYQDPYA-QEFGIRISDRLALVEARILPAPWLKGTWN--MMNKKMVDGGTVNYWACVNFSRTNDLAQGMAFAERALKSVE-LLIAILPDNNGSLKRICETDLGLVSQCCLGK-QYLANVALKINVKVGGRNTVLVDALSRR-LPLVSDTPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKELLISFGYKPGRIIFY-RDGVSEGQFYQVLLHELDAIRKAC-ASLEPNYQPLVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFTADGLQSLTNSLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEEAGSV-H-PLP-ALKDKV--KKVMFY- Selaginella_moellendorfii_SmAGO1a R-PGRGQGVKC-IVKVNHFLAELVMEQLVKLHRDSSLGHRVYDGRKSLYTA-GPL-P--------------PQEALQVLD-IVLRELPTHGRSFYSP-DLGPL---------------------MS-STAFIELPVVDFVIKKALRGVKVRKYRISGLTSQPTQESVMEYFDTYHYTIRSLPCLQVGNQ-ER-PYLPMEVCKIVEGQRYTKRQVTALLKVTCQRPRERTV-YHN-AYQDPYA-QEFGMRISDRLALVEARILPAPWLKGTWN--MMNKKMVDGGTVNYWACVNFSRTNDLAQGMAFAERALKSVE-LLIAILPDNNGSLKRICETDLGLVSQCCLGK-QYLANVALKINVKVGGRNTVLVDALSRR-LPLVSDTPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKELLISFGYKPGRIIFY-RDGVSEGQFYQVLLHELDAIRKAC-ASLEPNYQPLVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFTADGLQSLTNSLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEEAGSV-H-PLP-ALKDKV--KKVMFY- Selaginella_moellendorfii_SmAGO1b R-PGKGVGSKC-VVKANHFFAELVMELLVKLNREA-LGRRAYDGRKSLYTA-GPL-PIVIK-FA-A-RADLPQEALQVLD-I-WSPISHRDDHFIPL-ILDHSGMAWAGFTKVSGRRRSLDLLTMS-STAFIELPVVDFVIKKALRGVKVRKYRISGLTSQPTQESVVEYFETYGYTIRSLPCLAVGNQ-QR-PYLPMEVCKIVEGQRYSKRQINNLLKVTCQRPKDRTV-RHN-AYDDPYA-QEFGIRISDKLASVEARILPAPRLKGQWN--MMNKKMVNGGSVNYWACINFSRGAELALGMAFTERALKMLE-LLIAILPDSNGALKRICETDLGLISQCCLTK-QYLANVALKINVKVGGRNTVLVDALSRR-IPLVSDIPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKELLLAFGRKPLRIIFY-RQRWSER-------------RPAC-ASLEGNYQPPVTFVVVQKRHHTRLFTVVDTKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENTFTADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSL-T-PLP-PVKDNV--KSVMFY- Solanum_lycopersicum_SlAGO4a -----------------------VLDTVHETY-DTELAGKAYDGEKSLFTI-GAL-PVEIS-FA-A-KIPMSQEALRVLD-IILRQHAAKRQSFFHN-DPKDVGAGVRGFHSSFRTTQGLSLNIVS-TTMIIQGPVVDFLAKRVLKNLRVQEYKITGLSDRPCRETVFDYFNHRNIELRYLPCINVGKP-KR-PFFPIELCSLVSLQRYTKSQRSSLVEKSRQKPQERAL-KIN-QYAEPLL-RSCGISISNNFTQIEGRVLPPPKLKGRWN--FNNKRLVDPTKIERWAVVNFSARSDLIKGIMVEEKMFEQVK-FLLCLLPERKNCWKRKNLAEYGIVTQCIAND-QYITNVLLKINAKLGGLNSMLTVEHSPA-IPMVSKVPTIILGMDVSHGPGQS-D-V--PSIAAVVSSRQWPSISRYRASVRTQ-SPKVEMIDNLFK-----------------RDGVSESQFSQVLNVELDQIIEAC-KFLDEKWSPKFVVIVAQKNHHTKFFTIIDNKVCHPRNYDFYLCAHAGMGTTRPTHYHVLYDELGFSADDLQELVHNLSYVYQRSTTAISVVAPICYAHLAATQGQWMKSETSS-S-QLP-KLEEKP--TASATK- Solanum_lycopersicum_SlAGO4b R-RGLGKGRNI-QILTNHFQVNVVLDRVHETY-HAELAGKAYDGEKSLFTI-GSL-PVKIS-LA-G-KIPMSQEALRVLD-IILRQHAAKRQSFFHN-DSNDVGGGVRGFHSSFRTTQGLSLNIMS-TTMIIKGPVLDFLAKRVLKNLKVQEFKITGLSEKSCRETVYDYFNHCNIDLRYLPCLNVGKP-KR-PYFPIELCTLVSLQRYTKAQRASLVEKSRQKPQERAL-KMN-NYAEPLL-HSCGVTINSDFTQIEGRVLSAPELKGRWN--FNNKRFFESAKVEKWAVVNFSTNECLTGGISVEDKMFEEIK-FLLCLLPERKNCWKRKNLADHGIVTQCLAND-QYLTNLLLKINAKLGGLNSMLAVEVSRS-IPMISKVPTMILGMDVSHGPGQS-D-V--PSIAAVVSSRQWPSISHYRASVRTQ-SPKVEIIDNIFKELLLDFQRKPQQILVF-RDGVSESQFNQVLNIELDQIIEAC-KFLDEKWSPKFVIIVAQKNHHTKFFTIIDNKVCHPRNNDFYLCAHGGMGTTRPTHYHVLLDEVGFKPDELQELVHNLCYVYQRSTTATSIVAPIGYAHLAAAQGQWMKSETSS-S-QLP-RLQKNV--ASSMFF- Solanum_lycopersicum_SlAGOlike1 R-PDTGKVKSI-ALLANHFPVRFIREKLCADD-PTRFPLDAYDGKKNIFSA-VQL-PITIK-LV-A-ELKLPRDILQGME-LVMKENPTRGRCFYSN-EHLDFRFGVRGFQQSLKPTKGLALCLYS-VLALRKMPVLDFLAKGALVGLKVQKFLIKQLTDCKTRELLVDYFDKYQREIQFFPSLDIGKG-NK-KYVPMEFCVLVEGQRYPKETALFLKNISLARPQDRMV-RAGDGP-GAVT-RNFDIGVDRNMTRVPGRILPPPDLKCQWN--LVGKSVVEGKALQRWALIDFSAQFRLKDSINMEHKLLDGVQ-MIVCVMTSKHNGLKWVSETQIGVVTQCCLQD-QYLANLCMKINAKLGGSNMELMD----R-LPNFREDNVMFIGADVNHPAKNV-T-C--PSIAAVVATVNWPAANRYAARVCPQ-VHRTEKILEF--DLVHTYSVKPNKIVVF-RDGVSEGQFDMVLNEELLDLAKAI-YDS--NYQPAITLVVAQKRHHTRLFTVVDTIIVHPSDFDFYLCSHFGGGTSKPTHYHVLWDDNGFNSDSLQKLIYNMCFTFARCTKPVSLVPPVYYADLVAYRRMFQEMNSPS-S-KFY-DLHSDL--QNVMFF- Solanum_lycopersicum_SlAGOlike2 R-PDTGKVKQI-ELLANHFVVAF--------------------------NA-VQL-PITIN-LV-A-ELQLPRDILQGMD-LFMKDNPSRGRCFYSK-NP-DFRFGAKGFQQSLKPTEGLALCLYS-VLALRKMSVLNYLAHDALKGLKVQKFVIKKLTDRKTSELLVEYFDKYQREIQFFPSLDVGKG-SK-IYVPMEFCVLVEGQRFPKESAMFLKNMSLAQPNERMV-KAEDGP-GAIT-DNFGIKVDKNMTGVVGRVLPPPDLKCQWN--LVGKSVVEGKALQRWALIDFSSKIGLRDSINMEEKLLNFVQ-MIVCVMTSKHNGLKWVSETKIGVVTQCCLQD-QYLANLCMKINAKLGGSNMELMQ----R-LPNFNGDNVMFIGADVNHPSRDADK-Y--PSIAAVVATINWPAANRYAARVCPQ-KHRTEKILEF--DLVRTYSVKPNKIVVF-RDGVSGSQFDMVLNEELNDLVKDI-YDRY-KYKPEITLVVAQKRHHTRLFTVVDTQIVHPFDFDFYLCSHFGQGTSKATHYHVLWDENGFNSDILQRLIYNMCFTFARCTKPVSLVPPVYYADLVAYRRMFQEMNASS-S-RFY-NLQPDL--QNIMFF- Solanum_lycopersicum_SlAGOlike3 R-PDGGNDESV-SLHANHFPVDFIREKWLMDK-PAEFPCDAYDGIRNIYSA-VDL-PLTFK-LV-A-QLQLPRDVLQGMD-LVMKENPRRGRCFYSN-SA-SFNGGVKGFQQSLKLTSGLALCLYSELLVIPEIPVIEFLASDLLVGLKVQKFVIKELLPGETRTLLVDYFKNYTPKIKNLPSLNIGKG-DK-DYVPMEFCDLVEGQRFPKD----LLKTTSLEPKTRTV-LAKDGP-MTIP-DNFKIRVDDNMTQISGRILPVPVLKCQWN--LVGKSVVEGKALQRWALIDFSSKVKLKDSINMDENLLKVVQ-MILCVMTSKHNGLKWVSETKIGIVTQCCLHN-QYIVNLCMKINAKLGGSNMELME----R-LPNFSDDNVMFIGADVNHPGKDADK-Y--PSIAAVVATINWPAANKYAARVSPQ-KSRTEKIIEF--DLVLTYSVKPNKIVVF-RDGVSDSQFDMVLNEELTDLANAI-YESN-KYQPAITLVVAQKRHHTRLFTVVDTQIVHPSGFDFYLCSHYGQGTSKATHYHVLYDDNGFISVDLQRLIYNMCFTFARCTKPVSLVPPVYYADLVAYRRMFQEMKSPR-S-EFY-DLHHDL--KDIMFF- Sorghum_bicolor_SbAGO10a R-PGFGTGARC-VVKANHFLAELIMAELVRLYRASDLGMRAYDGRKNLYTA-GTL-PVAIK-FA-A-RADLPQEALQVLD-IVLRELANQGRSFYSP-DIRRLGDGLCGFYQSIRPTQGLSLNIMS-STAFIELPVIEFVIKKALRGVKVRKYRISGLTTQPTHESVVEYFEMYGFTIQHLPCLQVGNQ-KK-AYLPMEACKIVEGQRYTKRQITSLLKVTCQRPREQTV-HQN-GYQDPYA-KEFGINISEKLTSVEARVLPAPWLKGQWN--MVNKKVINGCKVSHWACINFSRSQELAQGMEFNVKALKNVE-LLLAILPDNNGPIKRICETDLGLITQCCLSK-QYLANVSLKINVKMGGRNTVLLDAISWR-IPLVSDIPTIIFGADVTHPTGED-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKELLISFGQKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADEMQTLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRRFYMEENQTS---PLP-AVKEKV--KRVMFY- Sorghum_bicolor_SbAGO10b R-PGKGTGDRC-IVKANHFFAELVMGELVRLYRISHLGGRAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTAGRSFYSP-NLGQLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVIKKALRGVKVRKYRISGLTSQATRETVVQYFETYGFSIQHLPCLQVGNQ-QR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPQERTV-HHN-AYEDPYA-QEFGIRIDERLAAVEARVLPPPRLKGQWN--MMNKKMVNGGRVSNWACINFSRNHELAVGMDFAERALKARD-LLIVILPDNNGSLKRICETDLGLVSQCCLSK-QYLANVALKINVKVGGRNTVLVDALTRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEVTKYAGLVSAQ-AHRQELIQDLFKELLISFGQKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFTADELQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSM-A-PLP-ALKENV--KRVMFY- Sorghum_bicolor_SbAGO10c R-PGKGTGSRC-IVKANHFIAELVMGELVNLYRHSHLDGRAYDGRKSLYTA-GAL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTAGRSFYSP-NLGQLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVTEFVIKKALRGVKVRKYRISGLTSQATRETVVQYFETYGFSIQHLPCLQVGNQ-QR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPHERTV-HHN-AYEDPYA-QEFGIRIDERLASVEARVLPPPKLKGQWN--MMNKKMVNGGRVSSWACINFSRTHELALGMDFAERALKGRD-LLIVILPDNNGSLKRICETDLGLVSQCCLNKQQYLANVALKINVKVGGRNTVLVDALTRR-IPLVSDVPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEVTKYAGLVSAQ-THRQELIQDLFKELLISFKQKPKRIIFY-RDGVSEGQFYQVLLHELDAIRKAC-ASLESDYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFTADGLQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSM-A-PLP-ALKENV--KRVMFY- Sorghum_bicolor_SbAGO1a R-PGKGSGTRC-LVKANHFFAELIIKELVNLYKQSYLGGRAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPSSGRSFFSP-DLGPLGDGLRGFYQSIRPTQGLSLNIMS-ATAFIELPVIEFVIKKALRGVKVRKYRISGLTTQATRESVVQYFETYGFSIQHLPCLQVGNQ-QR-PYLPMEVCKIVEGQRYSKRQIRALLEETCQHPRDRMV-KQN-AYKDDYA-QEFGIKISDRLASVEARILPAPRLKGQWN--MMNKKMVDGGKVRSWICVNFARNHELALGMDFAERALKARD-LLIGILPDNNGSLKRVCEIDLGIVSQCCCNK-QILANLALKINVKVGGRNTVLVDAVSRG-IPLVTDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIEDLYKELLVSFGEKPQRIIFY-RDGVSEGQFYQVLLYELNAIRKAC-ASLEAEYQPKVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFSADELQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSV-A-PLP-ALKDNV--KRVMFY- Sorghum_bicolor_SbAGO1b R-PGSGSGTRC-LVKANHFFAELVMEELVKLHKMSYLGGRAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTTGRSFFSP-DLGSLGEGIRGFYQSIRPTQGLSLNIMS-ATAFFELPVIDFVIKKALRGVKVRKYRIAGLTSLATRESVVQYFETYGFAIQHLPCLQVGNQ-QH-PYLPMEVCKIVEGQRYSKRQIRALLEETCQRPHDRMV-NHN-SYEDPYA-KEFGIKISERLASIEARILPAPRLKGQWN--MMNK--------------------------DFAERALKARD-LLIGILPDNNGSLKRICEIDLGLVSQCCCNK-QILANLALKINVKVGGRNTVLADAVSRR-IPLVTDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEVTKYAGLVSAQ-SHRQELIEDLYKELLISFGQKPQRILFY-RDGVSEGQFYQVLLHELDAIRKAC-ASLEANYQPQVTFIVVQKRHHTRLFTVVDSKICHPTEFDFFLCSHAGIGTSRPAHYHVLWDENNFTADALQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSL-A-PLP-VLKDSV--KNVMFY- Sorghum_bicolor_SbAGO4 R-PGIGRGQLA-QLYSNHFKVAVVIDKLQQTY-RAELSNKAYDGEKSLFTV-GGL-PVEIN-FA-A-KVPMSLEALRVLD-IILRQHSAEKQSFFYN-NPSDLGGGVRGFHSSFRGTQGLSLNVVS-TTMIVKGPVIDFLAKRALKGLRIAEFKIFGLSERICKETVYDYYK-KGIDLKYLPCINTGRA-KR-PYFPIELCCLVPLQRYTKAQRSSLVEKSRQKPQERAL-QRS-NYSDPML-RACGVSVAPKFTQVEGRILQAPKLKGRWN--FTNRKFYQTCSVDKWAVVNFSARRDLMRGIQMEDDMFGQIR-FLMCLLPERKNCWKRKCLAEFGIVTQCLAND-PYLLNLLMKINAKLGGLNSLLQVEASPS-IPHVSEVPTIILGMDVSHGPGQ--D-R--PSVAAVVSSRQWPLISKYRASVHTQ-SARLEMMSSLFKESLIDFKRKPDHIIIF-RDGVSESQFTQVINIELDQIIEAC-KFLDEKWSPKFTVIVAQKNHHTKFFTVVDNKVCHPKNFDFYMCAHAGMGTTRPTHYHVLHDEIGFSADEMQEFVHSLSYVYQRSTTAISVVAPICYAHLAAAQGTFLKSDTSS-S-ELP-RLHEKV--RSSMFF- Sorghum_bicolor_SbAGO7 R-PDGGGGTAI-PLYANHFLVCFIKNKLVEEN-SDILSGAAFDGRKNLFSP-IQF-QVNLR-LV-S-KLSGPQEYLHALD-VILREGAMEGRSLYPR-SMGEIGGGARGFFQSLRPTKGLALNVLS-LTAFHETGIIAYLVEKALKNIRVQRYHVHGLTEETTENTVVDYFEHYNHDIKFLPCLQIGK--SK-PYVPMELCMVCEGQKFLGKQTSKMLRMGCQRPSERVV-EGAFGTSNSYA-DQFNLQVSKDMTQLLGRVLLPPKLKRQWS--LMDSHVAEGSKIKSWALISFGGSNQLSSGILLNESKLKKIQ-LLICVMERRHRGLKRIAETSIGVLTQCCLSF-QFLANLALKINAKVGGSNVALYNSLPCQ-IPRVDKEPVMFMGADVTHPPLDD-S-S--PSVVAVVASMNWPSANKYISRMRSQ-THRKEIIERL--ELLEEFGKLPSRIIFF-RDGVSETLFYKVLTEELQAVRLAC-SRYP-GYKPAITFVVVQKRQHTRLFTVVDTVITHPREFDFYLCSHWGTGTSRPTHYRVLWDENNFKSDEMQQLIHNLCYTFARCTKPVSLVPPAYYAHLAAYRRLYLETATSR---PLP-KLRDSV--KGLMFY- Thellungiella_halophila_ThAGO1 R-PGKGQGKRC-IVKANHFFAELVMKQLVDLYRVSHLGKRAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPTSGRSFYSP-NIGPLGDGLRGFYQSIRPTQGLSLNIMS-STAFIELPVTEFVIKKALRGVKVRKYRISGLTAVATRESVVEYFETYGFRIQHLPCLQVGNS-NR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPLERTV-QLN-AYKDPYA-KEFGIKISATLASVEARILPPPWLKGQWN--MMNKKMINGGTVSNWICINFSRQQELAQGMAFNEKVLKTRD-LLIVILPDNNGSLKRICETELGIVSQCCLSK-QYMANVALKINVKVGGRNTVLVDALSRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEITKYAGLVCAQ-AHRQELIQDLFKELLIAFGHKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEAGYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFSADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSM-A-PLP-PLKDNV--KRVMFY- Thellungiella_halophila_ThAGO10 R-PGFGQGTKC-IVKANHFLADLIIAELVRLYKESDLGTRAYDGRKSLYTA-GEL-PVAIK-FV-A-RANMPQEALQILD-IVLRELSVKGRSFFSP-DIRRLGEGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIEFVIKKGLRGVKVRKYRVAGLTTQPTRESVIEYFEMYGFTIQHLPCLQVGNQ-KK-AYLPMEACKIVEGQRYTKRQITALLKVTCQRPRDRTV-QHN-AYQDPYA-KEFGVKISEKLASVEARILPAPWLKGQWN--MMNKKMINGMTVSRWACVNFSRSNELGQGMEFNEKALKHVE-LLLAILPDNNGSLKRICETELGLISQCCLSK-QYLANVSLKINVKMGGRNTVLLDAISCR-IPLVSDIPTIIFGADVTHPNGEE-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKDLLISFGQKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFIVVQKRHHTRLFTVVDTKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRRFYMEDNGSP---PLP-ALKENV--KRVMFY- Thellungiella_halophila_ThAGO2 R-PDKGGVRRV-NLFVNHFRVNFVRDKVFTDN-PGEFPFAAYDGQKNIFSA-AKL-PFTIK-QV-N-ELKFPRDVLQGMD-VVMKEHPSKGKSFFTR-GTEDFGFGVKGYRHTLKPTAGLSLCLYS-VLAFRKMSVIDYLVENELNGLQVQKLKIVGLSKKDTKNSIVEYFIKYGRDIVHIPCLDLGKN-GR-QLVPMEFCVLVEGQIYPKESALWLKKLSLVNPQQRMI-RSDDGPGGEIT-GNFGMKVDTKMTPVEGRVLKAPALKNQWN--LMRKGVARGSIVKHWAVIDFTASDQLMKGMQLEEELLRQVT-FVLCPMSRTHDGLKWIAETKLGLVTQCFLGD-QYRANLALKINAKVGGSNVELMD----T-FSFFKEDQVMFIGADVNHPAHNK-M-S--PSIVAVVGTLNWPQANRYAARVIAQ-PHRKEEIQGF--ELVKAHGKRPNKIVIF-RDGVSDGQFDMVLNVELLDVKLTF-EKN--GYNPKITVIVAQKRHQTRFFTVVDTKVIHPFEYDFYLCSHHGGGTSKPTHYYTLWDELGFTSDQIQKLIFEMCFTFTRCTKPVSLVPPVYYADMVAFRRIYYEEKSFR-Q-AVF-KLHKEL--ENVMFF- Thellungiella_halophila_ThAGO4 R-AGFGSGQKI-PLLTNHFKVNVVLDKVHETY-HSDLDGKAYDGEKTLFTF-GAL-PVEIS-YA-A-KIPLSQEAIRVLD-IILRQHAARRQSFFHN-DPSPVGGNIRGFHSSFRTTQGMSLNMVT-TTMIIKGPVVDFVAKRTLKNLRIQEYRITGMSDKLCKDTVAEYFNEKNLELQYLPCINVGKP-KK-PYIPLELCSLIPLQRYTKAQRSALVEKSRQKPQERAL-KVS-NYTEPLL-RSCGISISSNFTQVEGRVLPAPKLKGRWN--FNNKQFFEPTKIEKWAVANFSARDDLIRGIKIDEKMFEEIQ-FLLCLLPERKNCWKRKNLTEYGIVTQCMAND-QYLTNCLLKINAKLGGLNSVLSVERTPA-FTVISKVPTIILGMDVSHGPGQS-D-V--PSIAAVVSSRQWPLISKYRASVRTQ-PSKAEMIESLFKELLVDFKRKPEHIIIF-RDGVSESQFNQVLNIELDQIMEAC-KLLDENWDPKFLVLVAQKNHHTKFFTIIDNKICHPNNYDFYLCAHAGMGTTRPTHYHVLFDDIHFSPDELQELVHSLSYVYQRSTTAISVVAPICYAHLAAAQGTFMKSETSS-S-QLP-RLKDNV--ANSMFF- Thellungiella_halophila_ThAGO5 R-PGFGQGKKL-TIRANHFLVQVVMTTLVRTYGESHLAQKAYDGRKSIYTA-GPL-PVAIK-LA-S-RPDLPYEAIQVLD-VVLRDTPSEGRSFFDP-GLGPLGDGVGGYFQSLRLTQGLSLNIVS-ARSFYEILVTDFIVKKALKSLRVRSSKISGISSCPISQTVVQYFEKYNYRVKYLPAIQSGSD-SK-PYLPMELCQIAEGQRYTKKQVTALLRATCQRPPERMV-KKN-GYEIKLVSKEFGMSVTDQLASVEARVLPPPMLKGQWN--MIDKKMINGARVATWTCVSFSTRKQLTGGMQINEEALRDIQ-LLIVILPDLSGSIKRICETELGIVSQCCQSP-QYMENVALKINVKSGGRNTVLDDAIRRR-IPLITDRPTIIMGADVTHPPGED-S-S--PSIAAVVASMDWPEITKYRGLVSAQ-AHREEIIQDLYKEHLMAFGQKPQRIIFF-RDGVSEGQFNQVLLHETHAIHKAT-NSLEEGYLPRITFVIVQKRHHTRLFTVVDTKICHPTEFDFYLNSHSGIGTSRPAHYHVLYDDNGFTADALQMLTNNLCYTFARCTRSVSIVPPAYYAHLAAFRRYYMEDGGSS-K-HLP-AIKDNV--KDVMFY- Thellungiella_halophila_ThAGO6 R-AGLGRGSRI-ELSSNHFNVSVLIDQLYKTY-SSDLDGKAYDGEKTLYTV-GPL-PVQIQ-FS-T-KIPFAHDPLRVLD-TVLRQQAAERQAFFHN-DKNEVGEGVRGFHSTFRPTHGLSLNIVS-TTMILKGPVIEFLARKMLKNLRVMEFKIIGLSEKPCNQTVYEYFKQTYTDPTEFPCLDVGKP-NR-PYLPLEFCSLVSLQRYTKAQRASLVEKSRQKPLERAM-GTY-RYENPFL-AGCGISIEKQMTLVEGRVLNPPMLKGRWN--FNNKILLEPRAIKDWAVVNFSFPRELISGIEIDEKMIAKMF-FVLCVLPERKNSWKKVCLTEAGINTQCICND-QYLTNVLLKINSKLGGINSLLGIEYSCN-IPLINKIPTLILGMDVSHGPGRA-S-V--PSIAAVVGSKCWPNISRYRAAVRTQ-SPKLEMIDSLFQELFLEFKRKPKQIIIF-RDGVSESQFNQVLNIEVDQIIKAY-QRLGETDVPKFTVIVAQKNHHTKLFTVVDTKIVHPTNYDFYMCAHAGIGTSRPAHYHVLLNEIGFSPDDLQNIIHCLSYVNQRSTTATSIVAPVRYAHLAAAQAQFNKSEDER---DLP-RLDKKV--ASNMFF- Thellungiella_halophila_ThAGO7 R-PDSGGGSFI-YLLANHFLVKFIKQKLVETE-PSSFSGAAFDGRKNIYSP-VEF-QVNMR-LV-S-KFDGPQEYIHALD-VILRENPTEGRSFYSS-SMGEIGGGARGFFQSLRQTQGLALNMLS-ITAFHEIGVIAYLVEKALTNIRVQRYRVYGLTKEVTENRLMSYFDHYGYEIQFLPCLQISR--TR-PYLPMELCMICEGQKFLGKQAAKIMKMGCQRPNERVM-SGPVGPSGNQT-REFNLKVSSEMTLLKGRILQPPKLKRPRN--LVESRAFKGTRIERWALMSIGGSNELTQGVFLSESKLKEIQ-LIICVMEKKHKGLKRIAETRIGVVTQCCLNS-QFVANLALKINAKIGGSMAELYNSIPSH-IPRLLDEPVIFMGADVTHPPFDD-S-S--PSVAAVVGSINWPEANRYVSRMRSQ-THRQEIIQDL--ELLDDFNKLPSRIIFF-RDGVSETQFKKILQEELQSIKTAC-TKFH-GYNPSITFAVVQKRHHTRLFTVVDTVITHPKEFDFYLCSHLGVGTSRPTHYHILWDENEFTSDELQRLVYNLCYTFVRCTKPVSIVPPAYYAHLAAYRRLYIENGGPM-N-PLP-RLSDNV--KNLMFY- Thellungiella_halophila_ThAGO8 R-RGNGSGQKI-QLRTNHFR---ILENVQDTY-KSDLGSKAYDGDKTLFTV-GPL-PVAIT-FA-K-QISILQDAIRVLD-VILRQNAARRQSFFHN-DAKKEHGGFRGFHSSFRTTQGLSLNMVS-STLIVKGPVVDFLAERTLKNLRVQEYKITGLSRLPCKDKVFDYYKNHDIRLHDLRCINVGKP-KR-PYFPMELCHLVSLQRYTKAQRSNLVRESIQKPLDKAL-ENC-NYDDTLL-QECGVRIGSEFTQVEGHILPTPNLKGRWN--FNNKEFVKPVKVTGWAVVNFSVQRDLIRGMDVVEKMFEVME-FLLCIL--SKNSWKKRTLIEDGIKNQCIAKD-QYLTNVLLKINAKLGGLNSELAIERSLG-IPAVMRVPTIIIGMDVSHGPGQS-D-V--PSISAVVSSREWPLISKYKACVRTQ-SPKVEMIDNLFNELLDDF-MKPDHIIVF-RDGLSESQFNQVLNIELGQMKQAC-KFLEENWYPKFTVIIAQKKHHTRFFTIIDSKICHPRNNDFYLCAHAGMGTTRPTHYHVLYDEIGFSTDDLQELVHSLSYVYQRSTTAISVDFAAFFHDK----GTAMKSETSS-S-PMP-KLNKAV--ATSMFF- Thellungiella_halophila_ThAGO9 R-PGNGSGQKI-PLLTNHFRVNFILDKVQETY-QTDLGSKAYDGEKTLFTV-GAL-PVEIS-YA-A-KIPMLQDAIRVLD-IILRQSAARRQSFFHN-DTAAIGGGVRGFHSSFRTTQGLSLNITS-TTMVVQGPVVDFLARRVLKNLRVREYKISGLSEERCKDTVYEYFVCRNIPLRYVPCINVGKP-KR-PYIPMEHCELVTLQRYTKSQRASLVEKSRQKPTERGL-KKS-NYADLVL-RESGVSIGSNFTQVEGRVLPAPKLKGRWN--FNNKKLVEPVTVTRWAVVNFSARPDLIRGINVEDKMFEQIK-FLLCILAERKNSWKKKNLAELGIVTQCIAND-QYITNVLLKINAKLGGLNSLLAMERSPA-MPLVTQVPTIIVGMDVSHGPGMS-D-I--LSVAAVVSSRQWPLISKYKACVRTQ-SRKVEMIDNLFKELLIDFKRKPDHIIIF-RDGVSESQFNQVLNIELDQMMQAC-KFLDSNWDPKFTVIIAQKNHHIKFFTIIDNKICHPRNNDFYLCAHAGMGTTRPTHYHVLFDQIKFSTDDLQELVHSLSYVYQRSTTAISVVAPICYAHLAAAQGTVMKSETSS-S-PMP-TLNPEV--ASSMFF- Tribolium_castaneum_TcAGO1a R-PNLGRGRPI-GLKANHFQVTMIIETMVHAY-GKIFGNLVFDGRNNLYTR-DPL-PVTIK-WV-A-QVSLPYEAILALD-VVMRHLPSMGRSFFSS-PEGPLGGGRFGFHQSVRPSQKMMLNIVS-ATAFYKQPVIEFMFTKEIKGLKIRKYRVCNVTRRPAQMTVAKYFDKYKMKLRYLPCLQVGQE-HK-HYLPLEVCNIVAGQRCIKKQTSTMIKATARSAPDRLV-RRA-DFNDPYV-QEFGLTISNNMMEVRGRVLPPPKLQGVWD--MRGKQFFTGVEIRVWAIACFAPQQQLQKGMPIIEPMFRYLQ-LVVVVLPGKTPVVKRVGDTVLGMATQCVQSP-QTLSNLCLKINVKLGGINSILVPSI----RPKIFNEPVIFLGADVTHPAGDN-K-K--PSIAAVVGSMD-AHPSRYAATVRVQ-QHRQEIIQEL--ELLIMFGYKPHRIILY-RDGVSEGQFLQLLQHELTAIREAC-IKLESDYKPGITFIVVQKRHHTRLFTTVDVGITHPTEFDFYLCSHQGIGTSRPSHYHVLWDDSHLDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRRYHLVDSGEG-S-RAI-TVHADT--KKVMYF- Tribolium_castaneum_TcAGO1b R-PNLGRGRPI-GLKANHFQVTMIIETMVHAY-GKIFGNLVFDGRNNLYTR-DPL-PVTIK-WV-A-QVSLPYEAILALD-VVMRHLPSMGRSFFSS-PEGPLGGGRFGFHQSVRPSQKMMLNIVS-ATAFYKQPVIEFMFTKEIKGLKIRKYRVCNVTRRPAQMTVAKYFDKYKMKLRYLPCLQVGQE-HK-HYLPLEVCNIVAGQRCIKKQTSTMIKATARSAPDRLV-RRA-DFNDPYV-QEFGLTISNNMMEVRGRVLPPPKLQGVWD--MRGKQFFTGVEIRVWAIACFAPQQQLQKGMPIIEPMFRYLQ-LVVVVLPGKTPVVKRVGDTVLGMATQCVQSP-QTLSNLCLKINVKLGGINSILVPSI----RPKIFNEPVIFLGADVTHPAGDN-K-K--PSIAAVVGSMD-AHPSRYAATVRVQ-QHRQEIIQEL--ELLIMFGYKPHRIILY-RDGVSEGQFLQLLQHELTAIREAC-IKLESDYKPGITFIVVQKRHHTRLFTTVDVGITHPTEFDFYLCSHQGIGTSRPSHYHVLWDDSHLDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRRYHLVDSGEG-S-RAI-TVHADT--KKVMYF- Tribolium_castaneum_TcAGO2a K-P--GVGRPI-KIESNHLSLNVVMNLFARKH----YPKNAFDGRKNLYSP-KKL-PVVVK-LA-R-TVDLPQDALQCLD-IVLRNAPSNGRCFFTPPREGRLGDGMYGFYQSAIRGWQPLLNVVV-HKAFPELNVLDLVLEKFLKQLKVRIFRVNGLRAPPSQATVEKYYEVKRCRLQYLPTLWVGSR-QR-ELIPLEFCTVVSGQVVNRKQTSVMIKKAATSTDVRVL-RKA-NYSDPCV-REFGFSVNNSFEKLDGRVLQPPTLLGVWR--ADMNRFFVGAIVHKWTIVSCTRHDMIFRGMQITRDIIDYFD-LIIVVVPNSGPQVKQAAELNVGCLTQCIKNP-QIIANILLKINSKLNGTNHILSS----R-LPIM-SRPCIIMGADVTHPPDAK-D-V--PSVAAVTASHD-PNAFQYNICWRLQ-PPKVEIIEDL--EQLMFFRHKPETIVFF-RDGVSEGQFAEVRRAEISAIHQAC-KKLQRGYEPRITFLVVQKRHHTRLFTCVDTHITNPMMQDFYLVSHASIGVAKPTKYCTLWDDNNMSNDDIEELTYYLCHMFTRCNRSVSYPAPTYYAHLAAARKVYVEDLTQL-K-----QIQESIVKEKPMFF- Tribolium_castaneum_TcAGO2b T-P--GTGRRI-QIESNHLSLNLVMNLFGRKH----YPQNAFDGRKNLYSP-KKL-PVEVK-LA-R-TVDLPQDALQCLD-IVLRNAPSNGRCFFTPPRDGPLGDGMYGFYQSAIRGW-ALLNVVA-HKAFPKSNVLDIVFEKFIKQLKVRIHRVNGLGEPPSQATVERYYEVKRCKLQYLPTLWVGSR-ER-ELLPLEFCTVVGGQAINRKQTSAMIRKAATSTDVRTL-RTA-NYNDPCI-REFGFSVSNNFEKLDARVLNPPSLLGVWR--ADRNRFLVGATINKWTIASGTRYDMIFRGMQITRDFIDYFD-LIIVVVPNSGPQVKQAAELNVGCLTQCIKNP-QTVGNILLKINSKMNGTNHRLSPN---S-RPLIMKRPCMIMGADVTHPPDAR-D-I--PSVAAVTASHD-PNAFQYNICWRLQ-PPKVEIIEDL--EQLKFFGFKPESIVFF-RDGVSEGQFKQVQRAEIAAIQKAC-KMLQKDYEPKITFLVVQKRHHTRLFTCVDTHITNPRMQDFYLVSHASIGVAKPTKYCTLWDDNNMNNDDIEELTYHLCHMFTRCNRSVSYPAPTYYAHLAAARKVYIEDMSQL-K-----QIQEKIVKGKPMFF- Tribolium_castaneum_TcAGO3 TCSYRGEGTPI-KATANYILLNVLVNQALGEL--------VYDGDVCLYLP-CLA-FVTTT-LI-------LSECLHLYN-VLFKRIMHIGRNYFSP-DHKVPQHKLPGFCVHVDEMEGLMVCLTQ-HRVIRSQTVYELFVTKNVIGACVRTYIIDDIAWNMNPKCFIDYYEHYNIRIEDQPLLITGKI-ER-MCLIPELCYLTGLTDAMRNVMKDVAAFTRITPNQRYLDRVRQSEAKQVL-SGWGLSLADDTVDVKARVLPQEAIYTDWNKAISDNKLTGPVNITNWQL--YYTRQTIVRGCVIQETYMTAIQ-VAVFICPTLRADIKKMCCVNIPVASQVILVR-TIIHKIAMQITCKLGGTLWSVK-------IPVS---GWMVCGIDVYHGNNQS--------VCGFVASIN-GSMTKYFSKAMFQ-DGE---IGDY--QMLQAAGAFPSKVIVF-RDGVGDGQLEHCRKYEITQLQEVI-KEL--NIETTITFVVVQKRINTRIFTVVDNMVTRRQFYDFFLVPQSVRGTVNPTHYVVLVDEGNIKPDHLQRLAYKLCHLYYNWSGTIRVPAPCLYAHKLAAIGQYIK------S--------TQL--DDKLFY- Vitis_vinifera_VvAGO10like R-PGYGQGTKC-IVKANHFFTELIMNELVKLYKESDLGMRAYDGRKSLYTA-GEL-PVVIK-FV-A-RASLPQEALQILD-IVLRELSTRGRSFFSP-DIRRLGEGLCGFYQSIRPTQGLSLNIMS-SAAFIELPVIEFVIKKALRGVKVRKYRVSGLTSQPTRESVVEYFEMYGFTIQHLPCLQVGNQ-KK-AYLPLEACKIVEGQRYTKRQITALLKVTCQRPRDQTV-QHN-AYQDPYA-KEFGIKISEKLASVEARILPAPWLKGQWN--MMNKKMINGMTVSRWACINFSRSNELAQGMEFNEKALKHVE-LLLAILPDNNGSLKRICETDLGLISQCCLSK-QYLANVSLKINVKMGGRNTVLLDAISCR-IPLVSDIPTIIFGADVTHPNGED-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKDLLVSFGQKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFIVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRRFYMEENGSN-G-PLP-ALKENV--KRVMFY- Vitis_vinifera_VvAGO16like R-RGVGTGRRI-SLLTNHFKVSMVIDRLYLTY-SSELAGKAYDGEKSLYTV-GPL-PVAIS-YA-A-KIPLAQDALRVLD-IILRQQAANRQSFFHD-DSRDVGGGVRGFHSSFRTTQGLSLNMVS-TTMILTGPVIDFLAKKMLKNMRIMEFKITGLSEKPCNLTVYEYFKHRGIELSIMPCLNVGKP-KR-PYLPLELCLLVSLQRYTKAQRSTLVEKSRQKPQDRAV-RNY-QYEDPVL-SACGISIDRQLTQVDGRVLEAPKLKGRWN--FNHKKLLTPVRIERWAVVNFSARRELINGILIEEKMFEIVE-FLLCVLPEKKNSWKKRSLSDFGIVTQCISND-QYLTNVLLKINTKLGGTNSLLAIEHTSR-IPLIKDTPTMILGMDVSHGPGQA-D-V--PSIAAVVGSRCWPLISRYRASVRTQ-SPKVEMIDALYKELLVDFGRKPAQIVIF-RDGVSESQFNQVLNIELEQIMKAY-QHLGEVDFPKFTVIVAQKNHHTKLFTVVDTKIVHPRNYDFYMCAHAGMGTSRPAHYHVLLDEISFSPDDLQHLIHSLSYVYQRSTTAISIVAPVCYAHLAAQQGQFIKSETSS-A-ELP-RLHENV--RGSMFF- Vitis_vinifera_VvAGO1Blike R--KIGDGVTT-IVGGKSNVAGYFMV----------IGAVGY--------A-S---CYYLK-LA-A-RADLPQEALQVLD-IVLRELPTTGGSFYSP-DLGPLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVVKKALRGVKVRKYRISGLTSQATRESVFEYFETYGFVIQHWPCLQVGNQ-QR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPQERTI-HHN-AYEDPYA-KEFGIKISEKLASVEARILPAPWLKGQWN--MMNKKMVNGGTVNNWIGINFSRGQEFAQGMAFNERVLKARD-LLIVILPDNNGSLKRICETDLGLVSQCCLSK-QYLANVALRINVKVGGRNTVLVDAISRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIVAVVASQDWPEITKYAGLVCAQ-AHRQGLIQDLYKELLISFGQKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTS?PAHYHVLWDENKFTADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSM-T-PLL-ALKENV--KRVMFY- Vitis_vinifera_VvAGO1like R-PGKGVGKKC-IVKANHFFAELVMEQLVKLYRESHLGKRAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPTTGRSFYSP-DLGPLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVIKKALRGVKVRKYRISGLTSQATRESVVEYFETYGFVIQHWPCLQVGNQ-QR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPQERTV-HHN-AYEDPYA-KEFGIKISEKLASVEARILPAPWLKGQWN--MMNKKMVNGGTVNNWICINFSRGQELAQGMAFNERVLKARD-LLIVILPDNNGSLKRICETDLGLVSQCCLSK-QYLANVALKINVKVGGRNTVLVDAISRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEITKYAGLVCAQ-AHRQELIQDLYKELLISFGQKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFTADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSM-T-PLP-ALKENV--KRVMFY- Vitis_vinifera_VvAGO2like R-PDKGGIQST-MVRVNHFPVKFIKEKLFSDD-PSRFPLSAFDGEKNIFSV-VEL-PFTIK-LV-N-QLELPREILQGMD-VVMKENPARGRSFYPT-LFSDLGHGIRGFLHSLKPTAGLTLCLYS-VLAFRKIPVIDFLVEVALKGLKVQKYTISGLSGEDTRYGIIDYFEKYGKDIKYIPCLDLGKN-NR-KYVPMEFCILTEGQRFLKEGAQKLKNLSLVAPKVRMV-RSKTGPGGDMI-NNFGIEVNMRMTTVAGRVIMAPELKCHWN--FVGKSVVEGKHIDRWAVLDFSAYPKFIRGIRMDRELLLGVQ-ILVCVMARKDPGLKWFCETNIGIVTQCCLND-QYLANLALKMNAKLGGSNVELID----R-LPHFNEGYVMFVGADVNHPAWNS-A-S--PSIAAVVATVNWPAVNRYAARVRPQ-LHRTEKILNF--ELIETYRAKPDKIVVF-RDGVSEGQFDMVLNEELVDLKGAI-QRG--NYNPTITLIITQKRHQTRLFTVVDTTVVHPFEFDFYLCSHYGGGTSKPTHYHVLYDEHRFSSDQLQKLIYNLCFTFVRCTKPVSLVPPVYYADLAAYRRLYHDLERPA-S-RFY-RLHGDL--ENTMFF- Vitis_vinifera_VvAGO4 R-RGFASGQKI-ALTTNHFKVNVVIDRVHETY-DSELGGKAYDGEKSLFTV-GPL-PVEIS-FA-A-KIPMSQEALRVLD-IILRQHASKRQSFFHN-DPKDLGGGVRGFHSSFRTTQGLSLNIVS-TTMIVQGPVVDFLAKKMLKNLRVTEYKITGLSEKPCKETVFDYFNHRRIELRYLPCINVGKP-KR-PYFPIELCTLVSLQRYTKAQRASLVERSRQKPQERAL-RSN-NYAEPML-RSCGISISRDLTQIEGRVLAAPRLKGRWN--FNNKKLVEPTKIERWAVVNFSARRELIKGIHIDEKMFEEIQ-FLLCLLPERKNSWKRKNLSEYGIVTQCIAND-QYLTNVLLKINAKLGGLNSMLAVEHSPS-IPIVSKGPTIILGMDVSHGPGQS-D-V--PSIAAVVSSRQWPLISRYRASVRTQ-SPKVEMIDSLYKELLLDFKRKPDQIIIF-RDGVSESQFNQVLNIELDQIIEAC-KFLDEKWSPKFVVIVAQKNHHTKFFTVIDNKVCHPRNNDFYLCAHAGMGTTRPTHYHVLLDEVGFSSDDLQELVHSLSYVYQRSTTAISVVAPICYAHLAATQSQFMKSETSS-S-QLP-KLQESV--CNSMFF- Vitis_vinifera_VvAGO4Alike R-RGLGRGETI-QLVTNHFKVSMVMDKVHETY-HTEMAGMAYDGEKSLFTI-GSL-PVEIS-FA-A-KFPMLQDAARVLD-IILRQHAAKRQSFFDN-LPRPLGGGVRGFNSSFRATQGLFLNMVS-TTLVIQDPVRDFLAKRMLKNLRVAEWKISGLSERTCRNTVYDYFKHRKISLQYFPCINVGRS-KH-PYIPLELCTLVSLQRYTKPQRSSLVEKSRQKPQERAL-KSN-KYANPML-RSSGISISTQFTQVEGRILPTPSLKGRWN--FNNKELAQPTKIDPWLIASFSSRQDLIKGISMGDKMIGTMQ-FILCILPQKKNCWKRQCLSGCGVPIQCIAND-QYLTNVLLKINAKLGGLNSLLTMGYCPS-LHLISTIPTLILGMDVSHGPGRP-D-V--PSIAAVVSSRHWPSISQYRATVRTQ-SPKLEMIDSLFEGTLLDFKRKPEHIIIF-RDGVGESQFNQVLNIELEQIIEAC-KLLDEQWHPKFMVIIAQKNHHIRFFTIVDNTICHPRNNDFYLCAHAGMGTSRPTHYHVLLDELGFSADDLQQLVHSLCYVYQRSTTAVSLVAPVCYAHLAAAQAQFIKPESSS-G-QLP-SFHEKV--ADTMFF- Vitis_vinifera_VvAGO5like R-PGYGTGRKC-KVRANHFQVQVIIKQLVDLYKVSHLGKRAYDGSKSLYTA-GPL-PVAIK-LA-S-KGDLPQETIQILD-VVLRASPSEGRSFFST-QLGELGDGLRGYYQSLRPTQGLSFNIVS-ARSFYEILVTDFVVKKALKGVKVKRYKIAGVSSQPTNQSVVQYFQKYNIVLKYWPSLQAGSD-SK-PYLPMEVCKIVEGQRYTRKQVTALLRATCQRPSERMV-RKN-NFTDRVVRDEFGIRINEELTLVDARVLPPPMLKGQWN--MIDKKMVNGGTVQFWTCLNFSFRRELVNGMVFNEKVLVDVQ-LLIIILPDVTGSIKRICETELGIVSQCCQNK-QYFENVALKINVKVGGRNTVLFDAIQRK-IPLVSDLPTIIFGADVTHPPGED-S-S--PSIAAVVASMDWPEVTKYRGLVSAQ-HHREEIIQDLYKELLIAFGYKPSRIIFY-RDGVSEGQFSQVLLHEMDSIRKAC-ASLEEGYLPPVTFVVVQKRHHTRFFTVVDTKICHPTEFDFYLNSHAGIGTSRPTHYHVLYDENKFTADILQILTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRYYIEDSGSG-S-LLP-AVKENV--KDVMFY- Vitis_vinifera_VvAGO7like R-PDSGGGPVI-SLLANHFLVQFIKRKLVEEK-SVELSGAAFDGRKNLYSP-VEF-QINIK-LV-S-KFDGPQDYLHALD-IVLRESPTEGRSLYSS-SMGEIGGGARGFFQSLRPTQGLALNVFS-VTAFHEIGIIPYLVEKALKNIRVQRYRVHSLTEETTENRLVNYFDHYSYDIQFLPCLQITS--SK-PYLPMELCMICEGQKFLGKQTARILKMGCQRPRERVM-RGAVGPSGSQE-REFKLDVSREMTRLNGRVLEPPKLKRQWN--LLDSHVFEGTHIERWALISFGGTIQLSQGILLNESKLKKIQ-LLMCIMERKHKGLKRIAETSIGVVSQCCLSS-QFLANLALKINAKVGGCTVALYNSLPSQ-IPRLPDEPVIFMGADVTHPPLDD-F-S--PSIAAVVGSMNWPSANKYVSRMRSQ-THRQEIIQDL--EILDDFSQLPKRIIFF-RDGVSETQFYKVLQEELQAIRVAC-SRFP-SYRPPITFAVVQKRHHTRLFTVVDAVITHPREFDFYLCSHWGVGTSRPTHYHVLWDDNHFTSDELQKLVYNLCYTFVRCTKPVSLVPPAYYAHLAAYRRLYLETALAR-S-PLP-KLSENV--KKLMFY- Vitis_vinifera_VvMEL1like R-PGYGTGKRC-RITANHFRVELLIKELVHLYGQSHL-YRAYDGRRGIYTA-GPL-PVKIR-FA-T-STDIPYEIIHALD-VVLKDSLSNGKTFFPL-GLGEIGNGVNGFYQSLRPTQGLSLNIVS-SKSFYEIPVIEFALKKVLKGIKVRRYKIFDITEQPTNQSVIQYFEKYNIVLRYWPSLRSGKD-SR-PYLPMETCTIVAGQRYAKKQVASMLRMTCQRPWRRIA-DQD-DYRNDFV-KEFGVNVSVDMAAIDARVLPPPALKGQWN--AQHVKLYHGAVVEYWMCVNFS-NQHLVDGMDFAEAKLSDVQ-MLIIILPEVNAYIKRICETELGMVSQCCQNR-IYLENIVLKINVKAGGQNAILEDTLYGR-IPLLTDIPTIIFGADVTHPSGED-Q-G--PSIAAVVASMDWPTVVTYRGLVSAQ-PHRSEIIEDLFRELLLAFGLKPLRIIFF-RDGVSEGMFEMVLLKEMDAIRKAC-ASLEEGYLPPVTFIVVQKRHNTRLFTVVDTVICHPSEHDFYLCSHAGIGTSRPAHYRVLLDENKFSADALQMLANDLCYTYARCTRSVSIVPPVYYAHLAAFRKFYVEEGGSS-T-ELP-EIDPTV--KSVIRY- Vitis_vinifera_VvPNH1 R-PGYGQGRKC-VVKANHFLAQVIMAQLVKLHRDTDLGMRVYDGKRVLYTA-GLL-PVTIK-FV-G-ITSMPHEIIRIFD-IVLNQLAAQGRCLYSP-DIKQLGGGLQGFYKSIRPTQGLSLNIMS-STAFIELPVIDFVVKKALRGVKVRKYRISGLTSQPTRESVVEYFEMYGFTIRYLPCLQVGNQ-RK-VYLPMEACKIIGGQRYTKGQITSLLKVTCQRPRDRTI-NQN-GYKDPYA-KEFGITVDEKLASVEARVLPAPWLKGQWN--MTNKKMINGSTINYWACINFSRSHQLVQGMEFNKKALKHVE-LLIAILPDNNGSLKRICDTDLGLISQCCLSN-QYLANVSLKINVKMGGRNTVLLDALSSG-IPLVSDIPTIIFGADVTHPTGDD-S-C--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKELLLSFGKKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPSYQPPVTFVVVQKRHHTRLFTVVDSKICHPSEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADEIQSLTNNLCYTYARCTRSVSLVPPAYYAHLAAYRRFYMEENAIP---PLP-ALNEKV--KNVMFY- Volvox_carteri_VcAGOlike R-PNEGTGRAV-NLFANYFRLQTVLKAAATQY---KWPDGRFDGRKNLYLP-GQGIPVTTK-HV-N-VVDLPRDAMQVLD-VVIRHAFAVGRGYYYP-GDGPLTGGAKGFQQSFKLVEGLMLNLSS-FAAFMSRSLPELLAARNLSGFKVRKKPMIGLSEQGAANSVAEYF-STGRPLRYLPCANVGNR-MK-PYIPVELCTVVAGQRRMK-QSAGMISAAKQDPRTKQARRVQSTLGSGTE-AKWGLKLNTDLMRLPGRLLPTPVLQGSWN--LRDVKFHEARALDSWAVVCCIPKIDMCDGMAVVENAMRSAK-LLLVILPE-SLTIKRVSDIELGIPSQVVAGP-QYCANVAMKINNKLGGVNVTLSGGL-RY-LPVLGALPFMIMGADVTHPRADV-R-D--PSVAAVVASLD-QSMGRWGSRVLLQ-TGRQEVITGM--ELLLEFNTKPQRLVMY-RDGVSEGQFDQVLAEEYMAIRKAC-RELEESYRPAITFIVVQKRHNTRLLTVVDKGIVAPDGFDFYLNSHAGLGTNKPAHYHVLIDEIGFGADGVELLTYWLCYLYQRTTKSVSYCPPAYYADRAAFRRTLLAASDTA-S-TFA-GIHRDL--SNVLYF- Zea_mays_ZmAGO10a R-PGFGTGARC-VVKANHFLAELIMAELVRLYRASDLGMRAYDGRKNLYTA-GTL-PVAIK-FA-A-RADLPQEALQVLD-IVLRELANQGRSFYSP-DIRRLGDGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIEFVIKKALRGVKVRKYRISGLTTQPTHESVVEYFEMYGFTIQHLPCLQVGNQ-KK-AYLPMEACKIIEGQRYTKRQITSLLKVTCQRPREQTV-HQN-DYQDPYA-KEFGINISEKLTSVEARVLPAPWLKGQWN--MVNKKVINGCKVSHWACINFSRSQELAQGMEFNVKALKNVE-LLLAILPDNNGQIKRICETDLGLISQCCLSK-QYLANVSLKINVKMGGRNTVLLDAISWR-IPLVSDIPTIIFGADVTHPTGED-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKELLISFGQKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADEMQTLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRRFYMEDNQTS---PLP-AVKEKV--KRMMFY- Zea_mays_ZmAGO10b R-PGFGTGARC-VVKANHFLAELIMAELVRLYRSSDLGMRAYDGRKNLYTA-GTL-PVAIK-FA-A-RADLPQEALQVLD-IVLRELANQGRSFYSP-DIRRLGDGLCGFYQSIRPTQGLSLNIMS-STAFIELPVIEFVIKKALRGVKVRKYRISGLTTQPTHESVVEYFEMYGFTIQHLPCLQVGNQ-KK-AYLPMEACKIVEGQRYTKRQITSLLKI--------TV-HQN-GYQDPYA-KEFGINISEKLTYVEARVLPAPWLKGQWN--MVNKKVINGCKVSHWACINFSRSQELAQGMEFNVKALKSVE-LLLAILPDNNGPIKRICETDLGLISQCCLSK-QYLANVSLKINVKMGGRNTVLLDAISWS-IPLVSDIPTIIFGADVTHPTGED-S-S--PSIAAVVASQDWPEVTKYAGLVCAQ-AHRQELIQDLYKELLISFGQKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENNFTADEMQTLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRRFYMEENQTS---PLP-AVKEKV--KRVMFY- Zea_mays_ZmAGO1a R-PGKGTGDRC-IVKANHFFAELVMGELVTLYRQSHLGGRAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTAGRSFYSP-NLGQLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVIKKALRGVKVRKYRISGLTSQATRETVVQYFETYGFSIQHLPCLQVGNQ-QR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPQERTV-HHN-AYEDPYA-QEFGIRIDERLAAVEARVLPPPRLKGQWN--MMNKKMVNGGRVSNWACINFSRNHELAIGMDFSERALKARD-LLIVILPDINGSLKRICETDLGLVSQCCLSK-QYLANVALKINVKVGGRNTVLVDALTRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEVTKYAGLVSAQ-AHRQELIQDLFKELLISFGQKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFTADELQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSM-A-PLP-ALKENV--KRVMFY- Zea_mays_ZmAGO1b R-PGKGTGSRC-IVKANHFFAELVMKELVNLHRHSHLDGRAYDGRKSLYTA-GAL-PVVIK-FA-A-RADLPQEAIQVLD-IVLREFPTAGRSFYSP-NLGQLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVIKKALRGVKVRKYRISGLTSQATRETVVQYFETYGFNIQHLPCLQVGNQ-QR-IYLPMEVCKIVEGQRYSKRQITALLKVTCQRPQERTV-HHN-AYEDPYA-QEFGIKIDERLASVEARVLPPPRLKGQWN--MMNKKMVNGGRVSSWACINFSRNHDLALGMDFAERALKRLD-LLMVILPDNNGSLKRICETDLGLVSQCCLNKHQYLANVALKINVKVGGRNTVLVDALARR-IPLVSDVATIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEVTKYAGLVSAQ-THRQELIQDLFNELLISFGQKPKRIIFY-RDGVSEGQFYQVLLYELDAIRKAC-ASLESDYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFTADGLQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSV-A-PLP-ALKENV--KRVMFY- Zea_mays_ZmAGO1c R-PGKGTGDRC-IVKANHFFAELVMGELVTIYRQSHLGGRAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTAGRSFYSP-NLGKLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVIKKALRGVKVRKYRISGLTSQATRETVVQYFETYGFSIQHLPCLQVGNQ-QR-PYLPMEVCKIVEGQRYSKRQITALLKVTCQRPQERTV-HHN-AYEDPYA-LEFGIRIDERLAAVEARVLPPPRLKGQWN--MMNKKMVNGGRVSNWACINFSRNHELAVGMDFAERALKARD-LLIVILPDNNGSLKRICETELGLVSQCCLSK-QYLANVALKINVKVGGRNTVLLDALSRR-IPLVSDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEVTKYAGLVSAQ-AHRQELIQDLFKEG--NWEDHILQFLSF-RDGVSEGQFYQVLLYELDAIRKAC-ASLEPNYQPPVTFVVVQKRHHTRLFTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDENKFTADELQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSL-A-PLP-ALKENV--KRVMFY- Zea_mays_ZmAGO1d R-PGNGSGTRC-LVKANHFFAELVMEELVRLHKLSYLGGRAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTTGRSFFSP-DLGSLGEGIRGFYQSIRPTQGLSLNIMS-ATAFFELPVIDFVIKKALRGVKVRKYRIAGLTSQETRESVVQYFETYGFAIQHLPCLQVGNQ-QH-PYLPMEVCKIVEGQRYSKRQIRALLEETCQRPHDRMM-NHN-SYEDPYA-KEFGIKISERLASIEARILPAPRLKGQWN--MMNKKMVNGGRVRSWTCVNFARNRELARGMDFAERALKARDLLLIGILPDNNGSLKRICEIDLGLVSQCCCNK-QILANLALKINVKVGGRNTVLADAVSRR-IPLVTDRPTIIFGADVTHPPGED-S-S--PSIAAVVASQDWPEVTKYAGLVSAQ-SHRQELIEDLYNELLISFGQKPQRILFY-RDGVSEGQFYQVLLHELDAIRKAC-ASLEANYQPQVTFIVVQKRHHTRLFTVVDSKICHPTEFDFFLCSHAGIGTSRPAHYHVLWDENNFTADALQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRRFYMEDSGSL-A-PLP-ALKDSV--KKVMFY- Zea_mays_ZmAGO4 R-NGFGRGQQI-KLITNHFKVSLVIEKLQQTY-AAELANKAYDGEKSLFTI-GAL-PVELS-FA-A-KIPMTQEAIRVID-IILRQHSAKRQSFFHN-NPSDLGGGVRGFHSSFRATQGLSLNIVS-TTMIVKGPVIDFLAKRSLKNLRIQEQKIVGLSDRPCRETVFDYFKNRGIKLEYLPCINVGKP-KR-PYFPVELCSLLPLQRYTKAQRSSLVEKSRQKPQERVL-QRS-NYAEPML-KACGITIARNFIEVDGRVLQPPKLKGRWN--FNNKKLIRASSVEKWAVVNFSARRDLIKGIMVDEDMFEQVK-FLLCVLAERKNSWKKKCLAEFGIVTQCVAND-QYLTNVLLKINAKLGGLNSLLQIETSPA-IPLVSKVPTIILGMDVSHGPGHS-D-I--PSVAAVVSSREWPLISKYRASVRTQ-SPKMEMIDSLFKECLIDFKRKPDQVIIF-RDGVSESQFNQVLNIELQQIIEAC-KFLDEKWNPKFTLIIAQKNHHTKFFTVVDNKVCHPRNFDFYMCSHAGMGTTRPTHYHILHDEIGFNPDDLQELVHSLSYVYQRSTTAISVVAPICYAHLAAAQGQFIKSETSS-S-ELP-RLHEKV--RSSMFF- ; END; BEGIN CHARACTERS; [! TreeBASE Matrix URI: http://purl.org/phylo/treebase/phylows/matrix/TB2:M25074] TITLE Plant_and_Animal_AGOs; LINK TAXA = Taxa1; DIMENSIONS NCHAR=521; FORMAT DATATYPE=Protein SYMBOLS= "A C D E F G H I K L M N P Q R S T V W Y" MISSING=? GAP= -; MATRIX [ 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 210 220 230 240 250 260 270 280 290 300 310 320 330 340 350 360 370 380 390 400 410 420 430 440 450 460 470 480 490 500 510 520 ] [ . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ] Aedes_aegypti_AaAGO2 GRAI-KVEVNYIQLLLAYHYDAFSEFAFDGHKNAYAA-RRL-QVAMK-EA-A-VLDMPMSAIQCLD-IVLRTAYEKKSIYVIGSNHYGLFQSALLGARPFLNIVS-HKAFPTGPVLRILVDDFLKGMELSYTGKLFKYNSIKS-PANQTIDQYFLPVLHVGS-LVR-NMLPIELCSIPPGQALNKKQFIIRKSATDTATRLF-NQI-GYAPTI-KEFGVSVGNNFETVDGRILDPPGVWR--ADNMNELSWTILNLDRNIYQLDNIFDELD-LVFVVIPSPGRVKQKAELCVGLLTQCI-STISNIWLKINAKTNGSNHVLRKTVMYVGADVTHPPEQ-TPSVVGVAAGFRYNCCYRLQGKDEM--IRDLKQLRQFLPELIMYY-RDGVSEGQFQEVLTIELRAMQAAAPNITFIVVQKRHHARFFN-NNVQPTIVDRYITAPNQYQFFLVSHAAVGVAKPTKYCVLYDDCNPDQLQALTYYLCHMFTRCNRAVSYPAPTYYAHLAAYRGRVYIK----IR Amphimedon_queenslandica_AqAGO2like1 GRPI-GLRANHFQVKILYHYDIIEALVFDGKKNLYSR-KPL-PVSVK-YV-A-QVNLPFESIQALD-VVMRHLPSGRSFFALGNGRFGFHQSIRPSMKMMMNIVS-ATAFYKQCVLDFVHEKEIKGLKVEVTHRKYRVCNVTRRPASASVVQYFLPCLQVGQ-EKK-HYLPLEVCDLVPGQRCIKKSRMIKATSRTAPDRLV-ARA-NFDPYV-QDFGISVDTKMVTVTGRVLPPPGVWD--MRGKQVSVWAIIIFTFQLRKVEPLFRQLQ-LILVVLPG--KVKRVGDTLLGVATQCV-QTLSNLCLKINVKLGGINSIIREPVIFMGADVTHPAGD-EPSIAALVAPSRYSATVRIQQRQEL--ISELEMLIEFKPQRIIFY-RDGVSEGQFLQVLSHELASIRLACPGISFIVVQKRHHTRLFS-GNIPATTVDVGITHPTEFDFFLCSHAGVGTSRPSHYHVLWDDFTADDLQCLTYQLCHTYVRCTRSVSYPAPAYYAHLVAFRARYHLQAVK-IH Amphimedon_queenslandica_AqAGO2like2 GRPI-VLQTNHFPIKFLYHYDVIKEIAYDGTKNIYTS-KPL-PVIIK-VV-G-SIPLVQSAIQGLD-IVLRTLPSGRSFFTLGGGRTGYYQSVRPSMTITLNLVS-NTAFYKQPVLEFLKEKDIKGLKVKVTHRKYKVKDITQKSSRDSVVDYFLPCLHMEG-KNP-HYIPMEYCEVL-GQKCNKKSAMIRHTAKPAYERKI-HGA-HFDEYL-KNFGIKVSKRMSEVAGRVLDPPGSWD--TRGKSIKKWGIITARSELSKLEHILRTKD-IVIVILDG--KVKRVGDNTVGIRTQCV-ATMSNICLKINSKLGGTNSIPSSPFIIFGADVTHPPND-KPSLAAVTAAMDYRAKVKVLKRQEVFKIDELEMLLKFKPQRIIFY-RDGVSEGQFKEVILNEVAAIQKACPGITFLVVQKRHHTRLFA-GNVPPTTVDTDITHPREFDFFLCSHAGIGTSKPAHYHVLWDDFSADELQALTYKLCHCFVRCNRSVSYPAPTYYSHLAAFRARYTLQAIK-VN Anopheles_darlingi_AdAGO2 GNAM-TVEANFFRLLLAYHYDIFAQFAYDGQKSAYAA-HQV-TVTLK-IA-A-TVDLPMSAIQCLD-VVLRCAYEKRSVYALTKGHFGLFQSAILGSKPFLNVVS-HKAFPSGPLVGIFASSYVRGMDIVYRSKRMRCNGLRD-PANKTVEQYFLPVVHVGS-TIR-SYLPAELCEVPFGQALNKTAGIIRYSATSTDVRLT-DGI-QYSPTL-IDFGIGVGREFEKLPARIINPPGTWR--AEGKKPLRWRILNLDNSLSRLGNLLTDIA-ITIVILPS---VKQKAELRIGLLTQCI-STINNIMLKINTKTNGTNHKLRGKVMYIGADVTHPSDD--PSVVGVTAGFRYNCSVRLQGRDEM--IRDLRQVQLYLPERIMYY-RDGVSDGQFSEILTIEMQAIHAAIPAVTFIVVQKRHHTRFFN-ANVPPTIVDREITAPDRFEFYLVSHAAVGVAKPTKYVVLYDDCNPDELQAMTYNLCHMFARCNRAVSYPAPTYYAHHAAFRGRVYIK----IS Arabidopsis_lyrata_AlAGO1 GKRC-VVKANHFFAELLHQYDVMKQLAYDGRKSLYTA-GPL-PVVIK-LV-A-RADLPQEALQVLD-IVLRELPTGRSFYSLGDGLRGFYQSIRPTQGLSLNIMS-STAFIESPVIKFVCDKALRGVKVEVTHRKYRISGLTAVATRESVVEYFLPCLQVGN-SNR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPLERTV-ELN-NYDPYA-KEFGIKISTSLASVEARILPPPGQWN--MMNKKVNNWICINFSQELAQVEKVLKTRD-LLIVILPD--NLKRICETELGIVSQCC-QYMANVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAITKYAGLVCAQARQEL--IQDLELLIAFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Arabidopsis_lyrata_AlAGO10 GTKC-IVKANHFLADLLNQYDIIAELAYDGRKSLYTA-GEL-PVAIK-FV-A-RANMPQEAVQILD-IVLRELSVGRSFFSLGEGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIEFVAQKGLRGVKVEVTHRKYRVAGLTTQPTRESVIEYFLPCLQVGN-QKK-AYLPMEACKIVEGQRYTKRTALLKVTCQRPRDRTV-QHN-AYDPYA-KEFGMNISEKLASVEARILPAPGQWN--MMNKKVSRWACVNFSNELGQVEKALKHVE-LLLAILPD--NLKRICETELGLISQCC-QYLANVSLKINVKMGGRNTVLDIPTIIFGADVTHPNGE-EPSIAAVVAVTKYAGLVCAQARQEL--IQDLDLLISFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFIVVQKRHHTRLFS-GNILPTVVDTKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGIQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Arabidopsis_lyrata_AlAGO2 VRRV-NLYVNHFRVNFIRHYDVRDKVAYDGQKNIFSA-AEL-PFTIK-QV-N-ELKLPRDVLQGMD-VVMKEHPSGKSFFTFGFGVKGYRHTLKPTAGLSLCLYS-VLAFRKMSVIEYLKLKELTGLKVTVNHQKLTIVGLSMQDTKDSIVEYFIPCLDLGK-NGR-QFVPMEFCDLVEGQIYPKDLWLKKLSLVNPQQRMI-KSRNGPGEII-GNFGLKVDTNMTPVEGRVLKAPNQWN--LMKKGVKHWAVLDFTDNLIDLEELLRSVT-LVLCAMSR--KLKWIAETKLGLVTQCF-QYWANLALKMNAKVGGSNVELEDEVMFIGADVNHPARD-KPSIVAVVGANRYAARVIAQPRKEE--IQGFELVKAHRPNKIVIF-RDGVSDAQFDMVLNVELLDVKLTFPKITVIVAQKRHQTRFFK-GNVPSTVVDTKVIHPYEYDFYICSHHGGGTSKPTHYYTLWDEFTSDQVQKLIFEMCFTFTRCTKPVSLVPPVYYADMVAFRGRMYHEIFK-LH Arabidopsis_lyrata_AlAGO3 VQRV-NLSVNHFNVSFIRHYDVKEKVAYDGQKNIFSA-AEL-SFTIK-QV-NDELKLPRDVLQGMD-VVMKEHPSGKSFFTFRFGVKGYRHTLKPTAGLSLCLYS-VLAFRNMSVIDYLKLKELTGLKVTVNHQKLTIVGLSEYNTKDSIVKYFIPCLSLGK-KGR-QYVPMEFCNLVEGQIYPKESRLKHLSLVNPQRRMI-KLRDGPGDII-GNFGLKVATNMTTVEGRVLKAPNQWN--LTIKRIKHWAVLDFTEELTALEELLRSVT-LVLCAMSG--KLKWLAETKLGLVTQCF-QYLANLALKINAKVGGTNVELEDEVMFIGADVNHPAHD-KPSIVAVVGANRYAARVKAQTRKEE--IQGFELVNAHRPNKIVIF-RDGVSDGQFDMVLNVELQNVKDTFPLITVIVAQKRHQTRFFK-DNVLSTVVDTKIIHPFEYDFYLCSHHGAGTSKPTHYYVLYDEFKSDQIQKLIFDVCFTFTRCTKPVALVPPVSYADKAASRGRLYYEIFK-VH Arabidopsis_lyrata_AlAGO4 GQKI-PLLTNHFKVDVFFHYSILDKVAYDGEKTLFTY-GAL-PVEIS-YA-A-KIPLSQEAIRVLD-IILRQHAARQSFFHVGGNIRGFHSSFRTTQGMSLNMVT-TTMIIKGPVVDFLIARTLKNLRVKVSPQEFRITGLSDKPCRETVADYFLPCINVGK-PKR-PYIPLELCALIPLQRYTKASALVEKSRQKPQERAL-KVS-NYEPLL-RSCGISISSNFTQVEGRVLPAPGRWN--FNNKQIERWVVVNFSDDLIKVENMFKDIQ-FILCVLPE-KKWKKKNLTEFGIVTQCM-QYLTNLLLKINAKLGGLNSMLKVPTIILGMDVSHGPGQ-SPSIAAVVSISKYRASVRTQPKAEM--IESLELLVDFKPEHIIIF-RDGVSESQFNQVLNIELDQIIEACPKFLLLVAQKNHHTKFFP-DNVPPTIIDNKICHPKNNDFYLCAHAGMGTTRPTHYHVLYDEFSPDELQELVHSLSYVYQRSTTAISVVAPICYAHLAAAQLGTFMKLPK-LK Arabidopsis_lyrata_AlAGO5 GKKV-LIRANHFLVQILYHYDVMKLLAYDGRKSLYTA-GAL-PVAIK-LA-S-RPDLPYDTIQVLD-VVLRDKPSGRSFFHLGDGIRGFFQSLRLTQGLSLNIVS-ARSFYEIVVTEFISKKVLRTLKVKLLHKSAKISGISSCPISQTVIQYFLPAIQTGS-DTR-PYLPMELCQIDEGQRYTKRTALLRATCQRPQERLV-VKN-NYVHGLSKEFGMSVTSQLASIEARVLPPPGQWN--MINKKVASWTCVNFSKQLTGIEEALHDIQ-LLIVILPD--VIKRICETELGIVSQCC-QYMENVALKINVKTGGRNTVLDRPTIIMGADVTHPPGE-DPSIAAVVAITKYRGLVSAQAREEI--IQDLEHFIAFIPQRIIFY-RDGVSEGQFSQVLLHEMTAIRKACPRVTFVIVQKRHHTRLFS-GNIQPTVVDTTICHPNEFDFYLNSHAGIGTSRPAHYHVLLDEFTADQLQMLTNNLCYTFARCTRSVSIVPPAYYAHLAAFRARYYMELPA-IK Arabidopsis_lyrata_AlAGO6 GNPI-ELCTNHFNVSVFYQYTLMDQLAYDGEKTLYTV-GPL-PVQIH-FA-A-KIPLAQDALRVLD-IVLRQQAARQAFFHVGGGVRGFHSSFRPTHGLSLNIVS-TTIILEGPVLEFLKAKMLKHMRVKATHMEFKIIGLSQKPCNQTVYDYFLPCLDVGK-PNR-PYLPLEFCNLVSLQRYTKAALLVEKSRQKPLERAM-HTY-CFDPFL-AGCGISIEKQMTQVEGRVLKPPGRWN--FNNKMIKNWAIVNFSRELISVEKMIAKMH-FILCVLPE-RKWKKICLTEEGIHTQCI-QYLTNVLLKINSKLGGINSLLKIPTLILGMDVSHGPGR-APSVAAVVGISRYRAAARTQSRLEM--IDSLELFVEFKPKQIIIF-RDGVSESQFNQVLNIEVDQIIKAYPKFTVIVAQKNHHTKLFP-ENVPATVVDTKIVHPTNYDFYMCAHAGIGTSRPAHYHVLLDEFSPDDLQNLIHSLSYVNQRSTTATSIVAPVRYAHLAAAQ---FAKLPR-LH Arabidopsis_lyrata_AlAGO7 GSVI-YLLANHFLVKFIYHYNIKQKLAFDGRQNIYSP-VEF-QVNMR-LV-S-KFDGPPEYIHALD-VILRENPMGRSFYSIGGGARGFFQSLRQTQGLALNMLS-ITAFHEIGVIAYLQKKALKNIRIFVCHQRYRVYGLTEEITDNRLMSYFLPCLQISR--AR-PYLPMELCMICEGQKFLGKAKIMKMGCQKPNERVM-TGLVGPGNQT-REFNLEVSREMTLLKGRILQPPRPRN--LKESRIERWALMSIGNELTQLESKLKEIQ-LIICVMEK--KLKRIAETRIGVVTQCC-QFVSNLALKINAKIGGSMTELDEPVIFMGADVTHPPFD-DPSVAAVVGANRYVSRMRSQTRQEI--IQDLELLDDFLPNRIIFF-RDGVSETQFKKILQEELQSIKIACPSITFAVVQKRHHTRLFN-ENIPPTVVDTVITHPKEFDFYLCSHLGVGTSRPTHYHILWDEFTSDELQRLVYNLCYTFVRCTKPISIVPPAYYAHLAAYRGRLYIELPK-LS Arabidopsis_lyrata_AlAGO8 GKKI-HLLTNHFRVNFFFHYSILEKVAYDGDKNLFTA-GPL-PVAIS-FA-A-KIPMFQDAIRVMD-VILCQNAARQSFFHIGEGVKGFHSSFRTTQGLSLNIVS-TTMIVKGPVVGFLIGSTLKNLRVKVIPQEYKITGLSGLHCKDTVFDYFLPCINVGK-PNR-PYFPIELCELVSLQRYTKASNLVKESRQNPHQRAL-KNS-NYDPML-QECGVRIGSDFTQVEGRLLPTPGRWN--FNNKIVTRWAVVNFSRDLIRVEKMFERLN-FLLCIL-E-KKWKKKNLVQVGIVNQCI-HYLTNVLLKINAKLGGLNSVLKVPTIIIGMDVSHGPGQ-SPSIAAVVSISKYRACVRTQSKVEM--IDNLELLLDFKPNHIIIF-RDGVSESQFNQVLNIELDQM-----------KQKNHHTKFFP-DNVPPTIIDSNICHQHNNDFYLCAHAGMGTTRPTHYHVLYDEFDTDQLQELVHSLSYVYQRSTTAISLVAPICYAHLAAAQMGTAMKMPK-LN Arabidopsis_lyrata_AlAGO9 GQKI-PLLTNHFGVKFFFHYSILDKVAYDGEKTLFTV-GAL-PVEIS-YA-A-KIPMLQDALRVLD-IILRQSAARQSFFHIGGGVRGFHSSFRTTQGLSLNITS-TTMIVQGPVVDFLLARVLKNLRVQVTLREYKISGLSEHSCKDTVLNYYFPCINVGK-PKR-PYFPIEFCNLVSLQRYTKSAALVEKSRQKPPERGL-KDS-NYDPVL-QDSGVSIITNFTQVEGRILPTPGRWN--FNSRKVTRWAVVNFSRDLIRVENMFEQIL-FLLCILSE-RKWKKKNLVDLGIVTQCI-QYLTNVLLKINAKLGGLNSLLQVPTIIVGMDVSHGPGQ-SPSIAAVVSISKYKACVRTQSKMEM--IDNLELLLDFKPEHIIIF-RDGVSESQFNQVLNIELDQMMQACPKFTVIVAQKNHHTKFFP-DNVPPTIIDSQICHPRNFDFYLCAHAGMGTTRPTHYHVLYDEFATDDLQELVHSLSYVYQRSTTAISVVAPVCYAHLAAAQMGTVMKMPQ-LN Arabidopsis_thaliana_AtAGO1 GKRC-IVKANHFFAELLHHYDVMKQLAYDGRKSLYTA-GPL-PVVIK-LV-A-RADLPQEALQVLD-IVLRELPTGRSFYSLGDGLRGFYQSIRPTQGLSLNIMS-STAFIENPVIQFVCDKALRGVKVEVTHRKYRISGLTAVATRESVVEYFLPCLQVGN-SNR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPIDRTV-QLN-DYDNYA-QEFGIKISTSLASVEARILPPPGQWN--MMNKKVNNWICINFSQELAQVEKVLKTRD-LLIVILPD--NLKRICETELGIVSQCC-QYMANVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAITKYAGLVCAQARQEL--IQDLELLIAFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Arabidopsis_thaliana_AtAGO10 GTKC-IVKANHFLADLLNQYDIIAELAYDGRKSLYTA-GEL-PVAIK-FV-A-RANMPQEAVQILD-IVLRELSVGRSFFSLGEGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIEFVAQKGLRGVKVEVTHRKYRVAGLTTQPTRESVIEYFLPCLQVGN-QKK-AYLPMEACKIVEGQRYTKRTALLKVTCQRPRDRTV-QHN-AYDPYA-KEFGMNISEKLASVEARILPAPGQWN--MMNKKVSRWACVNFSNELGQVEKALKHVE-LLLAILPD--NLKRICETELGLISQCC-QYLANVSLKINVKMGGRNTVLDIPTIIFGADVTHPNGE-EPSIAAVVAVTKYAGLVCAQARQEL--IQDLDLLISFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFIVVQKRHHTRLFS-GNILPTVVDTKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGIQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYLELPA-LK Arabidopsis_thaliana_AtAGO2 VRRV-NLYVNHYKVNFIRHYDVRDKVAYDGQKNIFSA-VEL-PFTIK-QV-N-VLKLPRDVLQGMD-VVMKEHPSGKSFFTFRFGVKGYRHTLKPTAGLSLCLYS-VLAFRKMSVIEYLKLEELIGLKVTVNHQKLTIVGLSMQNTKDSIVEYFIPCLDLGK-NGR-QFVPMEFCDLVEGQIYPKDLWLKKLSLVNPQQRMI-KARNGPGEII-GNFGLKVDTNMTPVEGRVLKAPNQWN--LMKKGVKHWAVLDFTDNLIDIEELLRSVT-LVLCAMSR--KLKWIAETKLGLVTQCF-QYRANLALKMNAKVGGSNVELEDEVMFIGADVNHPARD-KPSIVAVVGANRYAARVIAQPRKEE--IQGFELVKAHRPNKIVIF-RDGVSDAQFDMVLNVELLDVKLTFPKITVIVAQKRHQTRFFK-GNVPSTVVDTKVIHPYEYDFYLCSHHGGGTSKPTHYYTLWDEFTSDQVQKLIFEMCFTFTRCTKPVSLVPPVYYADMVAFRGRMYHEIFK-LH Arabidopsis_thaliana_AtAGO3 VKGVINLSVNHFRVSFIRHYDVKEKLAYDGQKNIFSA-VEL-PFIIK-QV-K-ELKLPRDVLQGMD-VVMKEHPSGKRFFSFGYGVKGFHHTLKPTVGLSLCLSS-LLAFRKISVIEYLKLQELIGLKVTVDHQKFIIMGLSKDDTKDSIVEYFIPCLNLGK-KGR-EFVPMEFCNLVEGQIFPKEAWLKELSLVTPQQRMI-KSSDGPGDII-GNFGLRVDPNMTTVEGRVLEAPNQWN--LTTKGIKHWAVLDFTNKLIELEELLRSVT-LVLCAMTG--KLKWIAETKLGLVTQCF-QYLANLALKINAKVGGTNVELEDKVMFIGADVNHPAHD-NPSIVAVVGANRYAARVKAQSRKEE--IQGFELIEAHRPNKIVIF-RDGVSDGQFDMVLNVELQNVKDVFPQITVIVAQKRHQTRFFK-GNVPSTVVDTTIIHPFEYDFYLCSQHGAGTSKPTHYYVLSDEFNSNQIQKLIFDLCFTFTRCTKPVALVPPVSYADKAASRGRVYYEIFK-VH Arabidopsis_thaliana_AtAGO4 GQKI-PLLTNHFKVDVFFHYSILDKVAYDGEKTLFTY-GAL-PVEIS-YA-A-KIPLSQEAIRVLD-IILRQHAARQSFFHVGGNIRGFHSSFRTTQGMSLNMVT-TTMIIKGPVVDFLIARTLKNLRVKVSPQEFKITGLSDKPCRETVADYFLPCINVGK-PKR-PYIPLELCALVPLQRYTKASALVEKSRQKPQERAL-KVS-NYEPLL-RSCGISISSNFTQVEGRVLPAPGRWN--FNNKEIQRWVVVNFSDDLIKVENMFKDIQ-FILCVLPD-KKWKKKNLTEFGIVTQCM-QYLTNLLLKINAKLGGLNSMLKVPTIILGMDVSHGPGQ-SPSIAAVVSISKYRASVRTQPKAEM--IESLELLVDFKPEHIIIF-RDGVSESQFNQVLNIELDQIIEACPKFLLLVAQKNHHTKFFP-ENVPPTIIDNKICHPKNNDFYLCAHAGMGTTRPTHYHVLYDEFSADELQELVHSLSYVYQRSTSAISVVAPICYAHLAAAQLGTFMKLPR-LK Arabidopsis_thaliana_AtAGO5 GKKV-MVRANHFLVQVLYHYDVMKLLAYDGRKSLYTA-GPL-PVAVK-NV-T-STDLPYDTIQVLD-VVLRDKPSGRSFFHLGDGIRGYFQSLRLTQGLSLNIVS-ARSFYEIVVTDFISKKVLRTLKVKLLHKSAKISGISSLPIRETVVQYFLPAIQTGS-DTR-PYLPMELCQIDEGQRYTKRTALLKATCQRPPDRLV-VKN-NYD--LSKEFGMSVTTQLASIEARVLPPPGQWN--MIDKKVTSWTCVSFSKQLIGIEEALLDIQ-LLIVILPD--VIKRICETELGIVSQCC-QYMENVALKINVKTGGRNTVLDRPTIIMGADVTHPPGE-DPSIAAVVAINKYRGLVSAQAREEI--IQDLEHFIAFIPQRIIFY-RDGVSEGQFSQVLLHEMTAIRKACPRVTFVIVQKRHHTRLFS-GNIQPTVVDTKICHPNEFDFYLNSHAGIGTSRPAHYHVLLDEFTADQLQMLTNNLCYTYARCTKSVSIVPPAYYAHLAAFRARYYMELPA-IK Arabidopsis_thaliana_AtAGO6 GNPI-ELCTNHFNVSVFYQYTLMDQLAYDGEKTLYTV-GPL-PVQIH-YA-A-EIPLAQDALRVLD-IVLRQQAARQAFFHVGGGVRGLHSSFRPTHGLSLNIVS-TTMILEGPVIEFLKAKMLKHMRVKATHMEFKIIGLSSKPCNQTVYDYFFPCLDVGK-PDR-PYLPLEFCNLVSLQRYTKPVLLVESSRQKPLERAM-HTY-CYDPFL-AGCGISIEKEMTQVEGRVLKPPGRWN--FNNKMIKSWAIVNFSRELISVEKMIATMH-FILCILPE-RKWKKICLTEEGIHTQCI-QYLTNVLLKINSKLGGINSLLKIPTLILGMDVSHGPGR-APSVAAVVGISRYRAAVRTQSRLEM--IDSLELFVEFKPKQIIIF-RDGVSESQFEQVLKIEVDQIIKAYPKFTVIVAQKNHHTKLFP-ENVPATVVDTKIVHPTNYDFYMCAHAGKGTSRPAHYHVLLDEFSPDDLQNLIHSLSYVNQRSTTATSIVAPVRYAHLAAAQVAQFTKLPR-LH Arabidopsis_thaliana_AtAGO7 GSVI-YLLANHFLVKFIYHYNIKQKLAFDGRQNIYSP-VEF-QVNMK-LV-S-KFDGPPEYIHALD-VILRENPMGRSFYSIGGGARGFFQSLRHTQGLALNMLS-ITAFHEIGVIAYLQKKALKNIRVFVCHQRYRVYGLTEEITENRLMSYFLPCLQISR--AR-PYLPMELCMICEGQKFLGKAKIMKMGCQKPNERVM-TGSVGPGNQT-REFNLEVSREMTLLKGRILQPPRPRN--LKESKIERWALMSIGNELTQLESKLKEIQ-LIICVMEK--KLKRISETRIGVVTQCC-QFVSNLALKINAKIGGSMTELDEPVIFMGADVTHPPFD-DPSVAAVVGANRYVSRMRSQTRQEI--IQDLELLDDFLPNRIIFF-RDGVSETQFKKVLQEELQSIKTACPSITFAVVQKRHHTRLFH-ENIPPTVVDTVITHPKEFDFYLCSHLGVGTSRPTHYHILWDEFTSDELQRLVYNLCYTFVRCTKPISIVPPAYYAHLAAYRGRLYIELPK-LS Arabidopsis_thaliana_AtAGO8 GQKI-LLLTNHFRVNFFFHYSILEKVAYDGDKNLYTV-GPL-PVAIL-FAPP-EIPMLLDAIRVMD-CILSQNAARQSFFHIGEGVKGFHSSFRTTQGLSLNIVS-TAMIVKGPVVDFLIANTLKNLRVKVLPQEYKITGLSGLHCKDTVSDYFLPCINVGK-PNR-PYFPIELCELVSLQRYTKASNLIKESRQNPQQRAL-KTS-NYDPML-QECGVRIGSDFTQVEGRVLPTPGSWN--FKNK-VTRWAVVNFSDDLTRVDKMFQHLK-FLLCIL-E-KK--EKSCSMWN--CECI-QYLTNLLLKINAKLGGLNSVLRVPTIIIGMDVSHGPGQ-SPSIAAVVSISKYRACVRTQSKVEM--IDSLELLLDFKPNHIIIF-RDGVSESQFNQVLNIELDQMM-----------QINHHTKFFP-NNVLPTIIDSNICHQHNNDFYLCAHAGKGTTRPTHYHVLYDEFDTDQLQELVHSLSYVYQRSTTAISLVAPICYAHLAAAQMATAMKMPK-LN Arabidopsis_thaliana_AtAGO9 GQKI-PLLTNHFGVKFFFHYSILDKVAYDGEKTLFTV-GAL-PVEIS-YA-A-KIPMLQDALRVLD-IILRQSAARQSFFHIGGGVRGFHSSFRTTQGLSLNITS-TTMIVQGPVVDFLLARVLKNLRVQITLREYKISGLSEHSCKDTVLNYYFPCINVGK-PKR-PYFPIEFCNLVSLQRYTKSAALVEKSRQKPPERGL-KDS-NYDPVL-QDSGVSIITNFTQVEGRILPTPGKWN--FMRKTVTRWAVVNFSRDLIKVENMFEQIL-FLLCILAE-RKWKKKNLVDLGIVTQCI-QYLTNVLLKINAKLGGLNSLLQVPTIIVGMDVSHGPGQ-SPSIAAVVSISKYKACVRTQSKMEM--IDNLELLLDFKPEHIIIF-RDGVSESQFNQVLNIELDQMMQACPKFTVIVAQKNHHTKFFP-DNVPPTIIDSQICHPRNFDFYLCAHAGMGTTRPTHYHVLYDEFATDDLQELVHSLSYVYQRSTTAISVVAPVCYAHLAAAQMGTVMKMPQ-LH Arabidopsis_thaliana_AtAGOlike GKRC-IVKANHFFAELLHHYDVMKQLAYDGRKSLYTA-GPL-PVVIK-LV-A-RADLPQEALQVLD-IVLRELPTGRSFYSLGDGLRGFYQSIRPTQGLSLNIMS-STAFIENPVIQFVCDKALRGVKVEVTHRKYRISGLTAVATRESVVEYFLPCLQVGN-SNR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPIDRTV-QLN-DYDNYA-QEFGIKISTSLASVEARILPPPGQWN--MMNKKVNNWICINFSQELAQVEKVLKTRD-LLIVILPD--NLKRICETELGIVSQCC-QYMANVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAITKYAGLVCAQARQEL--IQDLELLIAFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Bombyx_mori_BmoAGO1 GRPI-MLRANHFQISMVHHYDIVETMVFDGRNNLYTR-DPL-PVTIK-WV-A-QVSLPYDAILALD-VVMRHLPSGRSFFSLGGGRFGFHQSVRPSQKMMLNIVS-ATAFYKQPVIEFMCEKEIKGLKIEITHRKYRVCNVTRRPAQMTVAKYFLPCLQVGQ-EHK-HYLPLEVCNIVPGQRCIKKSTMIKATARSAPDRLV-RRA-NFDSYV-KEFGLTISNNMMEVRGRVLPPPGVWD--MRGKQIRVWAIACFAQQLQKVEPMFKYLQ-LVVVVLPG--KVKRVGDTVLGMATQCV-QTLSNLCLKINVKLGGINSILNEPVIFLGVDVTHPAGD-NPSIAAVVGPSRYAATVRVQQRQEI--VHEMELLIMFKPHRIIMY-RDGISEGQFLHVLQHELTAVREACPGITFIVVQKRHHTRLFS-GNIPATTVDLGITHPTEFDFYLCSHQGIGTSRPSHYHVLWDDFGSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVAIT-VH Bombyx_mori_BmoAGO2 SRTV-PILTNYLAMKIIYRYDVFKLVAFDQTKNCYSL-TPL-PVSFK-AS-G-IVDYPTDTIQCID-IVLKQGTLGRQYFMLGDGLTGLFQSAIFTSA-FINVVA-HKGFPKQPMIDAFTREFIRGLKVVSKIREHICNGVVDPPSRQTVYEYFLNCLWVGP-KDK-NYLPMELVEVAYGQARNKQSTMVREAATPPDVRVI-QKM-NYNQFF-KTYGLEIANEFYQVEAKILEAPGVWQ----ANCLNSWGFIAIESKLMNLHKSMLHAN-FLVVVVSG--RLKQIAELKVGILTHVF-QTARNILLKVNSKLMGINQALGGAVMIVGADVTHPPDQ-SPSIAAVTACYIYNIELSIQTKKEM--IVQFDHFHAFLPKKVFVF-RDGVSEGQFAEVMKSELTGLHRAYPEVLFILVQKRHHTRFFR-FNVDPTVVDRDIVHPRELDFYLVSHQAIGTARPTRYHAVCNDIPENEVEHLAYYLCHLYARCMRAVSYPAPTYYAHLACLRARSLTYNPKRLR Bos_taurus_BtAGO2 GRTI-KLQANFFEMDIIYHYEIVEHMVFDGRKNLYTA-MPL-PVSIK-WV-S-CVSLPFETIQALD-VVMRHLPSGRSFFTLGGGRFGFHQSVRPSLKMMLNIVS-ATAFYKQPVIEFVCEKEIKGLKVEITHRKYRVCNVTRRPASHTVAQYFLPCLQVGQ-EQK-HYLPLEVCNIVAGQRCIKKSTMIRATARSAPDRLM-RSA-SFDPYV-REFGIMVKDEMTDVTGRVLQPPGVWD--MRNKQIKVWAIACFAEQLRKVEPMFRHLQ-LVVVILPG--KVKRVGDTVLGMATQCV-QTLSNLWLKINVKLGGVNNILQQPVIFLGADVTHPAGD-GPSIAAVVGPNRYCATVRVQQRQEI--IQDLELLIQFKPTRIIFY-RDGVSEGQFQQVLHHELLAIREACPGITFIVVQKRHHTRLFS-GNIPATTVDTKITHPTEFDFYLCSHAGIGTSRPSHYHVLWDDFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVAVQ-VH Brachypodium_distachyon_BdAGO12like GKRC-RVRANHFLVQVIYHYDIINELVYDGRKSIYTA-GAL-PVTIK-HA-S-NLDLPQDTIQALD-IALRECPTSRSFFSIGNGARGYYQSLRPTQGLSLNIIL-ATAFYKQPVMAFAVEKALRGVRVVATHIRYKISGIPAAPLKESVVQYFWPCLQAGS-DSR-PYLPMEVCSIVEGQRYSRKTGILRMACERPAQRIV-NRN-NYDHYS-KEFGMNVMNQLTLVDARVLPAPGQWN--MINKRMNYWACITFSHDLAQVESAIRNIE-LLIIILPD--IIKRLCETELGLMTQCC-QYLENLSLKINVKTGGSNTVLDVPTIVFGADVTHPPGE-DPSIAAVVAVTKYKCLVSSQGREEI--IADLELLVSFKPSRIIFY-RDGVSEGQFSQVLLYEMDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDTKIFHPTEFDFYLCSHAGIGTSRPTHYHVLLDEFSADALQTLTYNLCYTYARCTRSVSIAG--TWEKLTGWGEACCLRMAA-MG Brachypodium_distachyon_BdAGO16like GKPI-RLMSNHFAVKLFYQYSVIDKMAYDGEKCLFTV-GPL-PVGIS-YA-A-KIPLAQDALRVLD-IVLRQQQARQSFFSLTGGVRGLHSSFRTTMGLSLNMVS-TTMIVTGPVVHFLLTKMLKNLRVKATHMEFKIIGLSDQPCSRTVEEYFLPCLDVGK-PKR-PYLPIELANMVSLQRYTKAATLVEKSRQKPQDRAV-KSN-KYDPIF-STCGIKIEKQLTHVDGRVLSAPGRWN--YNNKKIERWAIVNFSRDLINVERMFEKVE-FLLCVLPE-RKWKKKNLHEMGIVTQCI-QYFTNVLLKINAKLGGMNSKLKKPTLILGMDVSHGPGR-SPSIAAVVGISRYRASVRTQSKVEM--IDSLELLLDFKPTQIIIF-RDGVSESQFSQVLNLEVNQIIKAYPKVTVIIAQKNHHTKLFS-DNVPPTVVDSGIVHPKQYDFYMCAHAGPGTSRPTHYHVLLDEFSPDDLQKLVLSLSYVYQRSTTAISVVAPICYAHLAAAQMSQFMKLPR-LH Brachypodium_distachyon_BdAGO18like GKAC-IVKANHFFVGLLHQYDVMSRLAYDGRKTLYTA-GQL-PVAIK-HV-T-LVSLPSQALQVLD-IVLRDMILGRSFFSLGLGIKGFYQSIRPTQGLSLNIMS-STAFVKQSVIKFVQDKALKGVRVEVTHRKYCISGLAGTA-RDTVMDYFLPCLDVGT-TQK-PYLPMEVCNIVPGQRYQKKSNMMQITCQQPLQRTV-RCN-NYTKRA-NEFGIEVDYEPTSVQARVLPAPGAWN--MRGKKVVNWLCINFCNGLSNFEANLHNVD-LLLALLPD--KIKRICETDIGVMSQCC-QFFANVAIKINAKCGGRNSVFAKPTIIFGADVTHPALD-DPSIASVVAVTKYHGVVRAQGREEL--IQGLELLRSFRPEQLIFY-RDGVSEGQFKQVLEKEIPEIEKAWPQITFIVVQKRHHTRLFS-GNVLPTVVDRQVCHPTEFDFFLCSHAGIGTSRPTHYHVLRDDFTADALQSLTNNLCYTYASCTRSVSIAPPVYYAHKLAFRARFYQTLPE-IK Brachypodium_distachyon_BdAGO1Alike GNRC-IVKANHFSAELLHQYDVMGQLAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTARSFYSLGDGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVAQKALRGVKVEVTHRKYRISGLTSQATRETVVRYFLPCLQVGN-PQR-PYLPMEVCKIIEGQRYSKRTALLKVTCQRPQQRTV-NHN-AYDPYA-QEFGIRIDKKLASVEARILPPPGQWN--MKNKKVKDWTCINFSHELAVVERALKARD-LLIVILPD--NLKRICETDLGLVSQCC-QYLANVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAITKYAGLVSAQTRQEL--IQDLELLISFKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGLQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYLELPD-LK Brachypodium_distachyon_BdAGO1Blike GDRC-VVKANHFFAELLHQYDVMAELAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTGRSFYSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIEFVAQKALRGVKVEVTHRKYRISGLTSQATRETVVQYFLPCLQVGN-QQR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPQERTV-HHN-AYDPYA-QEFGIKIDERLASVEARVLPPPGQWN--MMNKKVSNWACINFSHELAIVERALKARD-LLIVILPD--NLKRICETDLGLVSQCC-QYLANVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAVTKYAGLVSAQARQEL--IQDLELLISFKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADELQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Brachypodium_distachyon_BdAGO1Clike GTKI-LVKANHFFTQLLHHYDVINELVYDGRKSLYTA-GPL-PVVIK-FS-A-QANLPQEAIQVLD-IVLRQLPSGRSFFSLGDGLSGFYQSIRPTQGLSLNIMS-ATAFIELPVVEFVANKALRGVNVEVTHRKYRISGLTAQATRESVVQYFLPCLLVGN-QQR-QYLPMEVCKIVKGQRYSKRRNLLDQTCRHPRDRMV-KQN-AYDPYA-KEFGIKISDRLASVEARILPAPGQWN--MMNKKVRSWMCVNFAHDLALVERALKARD-LLIGILPD--NLKRVCETDLGIVSQCC-QILANLALKINVKAGGRNTVLDKPTIIFGADVTHPPGE-DPSIAAVVAVTKYVGIVSAQARQEL--IEDLELLISFKPQRIIFY-RDGVSEGQFYQVLLFELDAIRRACPTVTFVVVQKRHHTRLFT-GNILPTVVDSKICHPNEFDFYLCSHAGIGTSRPAHYHVLRDEFTADGLQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Brachypodium_distachyon_BdAGO1Dlike GTRC-LVKANHFLAELLHQYDVMEELAYDGRKSMYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTGRSFFSLGEGIRGFYQSIRPTQGLSLNIMS-ATSFFELPVIDFVAQKALRGVKVEVTHRKYRISGLTSQATRESVVQYFLPCLQVGN-QQR-PYLPMEVCKIVEGQRYSKRRVLLEETCQRPHDRMV-NHN-SYDPYA-KEFGIKISERLSSVEARILPAPGQWN--MMNKKVRSWLCVNFARELARVERALKARE-LLIGILPD--NLKRVCEIDLGLVSQCC-QILANLALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAVTKYAGLVSAQSRQEL--IEDLELLISFKPQRIIFY-RDGVSEGQFYQVLLHELDAIRKACPQVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFFLCSHAGIGTSRPAHYHVLWDEFTADGLQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Brachypodium_distachyon_BdAGO2like GVEV-KLLVNHFTVKFMFHYDAKAELAYNGMGRLFTF-AEL-PAFAK-LE-N-KVSLPEYLSQGLD-CIVREASSGQTFYSQPSAVRGTKQTLKHTNGPILCVYS-FMDFCKGGSVRSLVKRHLKGLYVTLNYRKYKVHGLTKQLAHQKLLEYYLPCLSLSKNSNR-PSVPIELCSLHEWQRYPKENQQPNNRPPKLSERMV-KDVDGPGLGG-EQFKISLGEQMTEVMGRILPPPCQWN--ITRKKLQYWGILDFSRDIFFLYKVLSAAQ-LLFCPMSE--QLKQICETKLGIQTQCL-QYMSNLALKINSKLGGSNVQLGSHFMFIGADVNHPPND-NHSIAAVVAASKYVPRIRAQKRCEE--IVELELIQVYKPQKIIYF-RDGVSDNQFEMVLKQELKQLENMLPTITAIVAKKRHHTRLFD-RNVLPTVVDTDVVNTADQDFFLCSHDGLGTSRPTHYHRLKDDFEPVDLQKLVYNMCFLFARCTKPVSLTTPVKYADLAAYRGRDYYDFPILLH Brachypodium_distachyon_BdAGO4Alike GKPI-QLVTNHFKVSLFHHYYVIDKLAYDGEKSLFTI-GAL-PVELN-FA-S-RIPMTQEAIRVID-IILRQHAARQSFFHLGGGVRGFHSSFRATKGLSLNIVS-TTMIVKGAVVDFLIARALKNLRIKTSPTEFKIVGLSERNCYESVYDYFFPCINVGK-PKR-PYFPIELCSLVPLQRYTKSSSLVEKSRQKPQERVL-KRS-SYDPML-KACGISIAQGFTQVPGRVLQPPGRWN--FNNKRVERWAVVNFSRDLIKVEAMFETVK-FLLCILAE-RKWKRKCLAEFGIVTQCV-QYLTNVLLKINAKLGGMNSLLKVPTMILGMDVSHGPGQ-APSIAAVVSVSKYRASVRSQSKSEM--IDSL---------------RDGVSESQFTQVLNKELDQINEACPKFTLIVAQKNHHTKFFP-DNVPPTVVDNVVCHPKNYDFYMCAHAGMGTTRPTHYHILHDDFTADDLQDLVHSLSYVYQRSTTAISVVSPICYAHLAAAQVSQFVKLPR-LH Brachypodium_distachyon_BdAGO4Blike GQPI-QLLSNHFKVSVFHHYDVIDKLAYDGEKSLFTI-GAL-PVELR-FA-A-KIPMSLEAIRVLD-IILRQHAARQSFFHLGGGVRGFHSSFRGTQGLSLNIVS-TTMIVQGPVIDFLKARALKNLRIKTIPTEFKIVGLSDRNCNETVYEYFLPCINVGR-PKR-PYFPAELCMLLPLERYTKASSLVEKSRQKPQERAL-KRS-NYDPML-RACGISIARNFTQIEGRVLQAPGRWS--LKHKKVERWAVVNFSRDLKRVDAMLAQLN-FLLCLLPD-RKWKKKCLADLGIVTQCL-QYIDNVLLKINAKLGGLNSLLKVPTIILGIDVSHGPGQ-SPSIAAVVSISKYRATVNTQSKLEM--VSSLVSLIDFKPDHVIIF-RDGVSESQFTQVINIELEKIIEACPKFTVIVAQKNHHTKFFP-DNVPPTVVDKQVCHPKNFDFYMCAHAGMGTSRPTHYHVLHDEFTADELEEFVHSLSYVYQRSTTAVSVVAPICYAHLAAAQVGTFLKLPG-LH Brachypodium_distachyon_BdAGO7like GAVI-PLSANHFLVRFIFHYDIKNKLAFDGRRDLYSP-FEF-QVNIR-LV-S-KLSGPQDYLHALD-VILREGAMGRSLYPIGGGARGFFQSLRPTKGLALNVLS-LTAFHETGMIAYLQKKALRNIRVFVCHQRYHVHSLTEETTENMVMDYFLPCLQIGR--SK-PYVPMELCVVCEGQKFLGKSKILKMGCQRPSERAV-EEAFGANSYA-DQFNLQVSKDMTQLSGRVLLPPRQWS--LLDSHIKSWALISFGNQLSSLESKLKKIQ-LLICVMER--RLKRIAETSIGVVTQCC-QFVANLALKMNAKLGGCNVSLDEPVMFMGADVTHPPLD-DPSVVAVVAANKYISRMRSQTRKEI--IEHLELLEEFLPARIIFF-RDGVSETQFDKVLKEEMHAVRMTCPLITFIVVQKRHHTRLFD-QNIPPTVVDTVITHPREFDFYLCSHWGTGTSRPTHYHILLDEFGSDELQQLIHNLCYTFVRCTRPVSLVPPAYYAHLAAYRGKLYLELPK-LS Brachypodium_distachyon_BdMEL1like GRKV-MIRANHFLVDVLFHYDVLSELAYDGRKSLYTA-GSL-PITIR-IA-G-RTDLPQETIQVLD-VVLRESPSSRSFFSIGEGLRGYYQSLRPTQGLSLNIIS-ATSFFKVTVIQFVQEKALRGVRVETNHRRYKITGITPIPMSQTVVQYFWPCLQSGS-DSR-PYLPMEACKIVEGQRYSKKTNILRATCQRPQQRMV-LHN-KYDKFA-QEFGIKVCSDLVSVPARVLPPPGQWN--MINKKIDKWACITFSCDLVQIENALRDVQ-LLIVILPE--VIKKVCETDLGIVSQCC-QYLENVALKINVKAGGRNTVLEVPTIIFGADVTHPPGE-DSSIAAVVAITKYRGLVSAQPRQEI--IEDLELLIAFRPERIIFY-RDGVSEGQFSHVLLHEMDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDLMICHPTEFDFYLCSHAGIGTSRPTHYHVLYDEFTADALQSLTNNLCYTYARCTRAVSVVPPAYYAHLAAFRARYYVELPN-IK Brachypodium_distachyon_BdMELlike GQKI-TVRANHFLVRVVCHYDLMSELAYDGSKSLYTA-GEL-PVTIR-FA-A-RANLPQDTIQALD-VALRETPSSRSFFSIGDGLKGYYQSLRPTQGLSLNITS-STSFYKISVIKYVQAKALRGVRVETTHSSYKITGITSVPLIQTVAQYFWPCLQSGN-DSR-PYLPMEVCTIIEGQRFTRKTGILRATCQRPQLRMV-ESN-NYDRMA-REFGIDVANQMVNVHARVLPPPGQWN--MINKKVQRWTCLNFSDDLVRIEGALKDVQ-LLIVILPD--VVKKVCETDLGIVTQCL-QYFENVALKINVKAGGRNTALDRPTIIFGADVTHPAGE-DASIAAVVAITKYKAVVSAQPRQEI--IQELELLISFKPQRIIFY-RDGVSEGQFAQVLLHEMDAIRKACPPVTFVVVQKRHHTRLFS-GNILATVVDTNVCHPTEFDFYLCSHAGIGTSRPTHYHVLFDEFSADELQLLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRARYYDELPQ-IK Brachypodium_distachyon_BdPNH1like GARC-VVKANHFLAEILTQYDIIAELAYDGRKSLYTA-GTL-PVVIK-FA-A-RADLPQEAVQVLD-IVLRELANGRSFYSLGDGLCGFYQSIRPTQGLSLNIMS-STAFIELPVIEFVAQKALRGVKVEVTHRKYRISGVTAQPTHESVVEYFLPCLMVGN-QKK-AYLPMEACKIVEGQRYTKRTSLLKVTCQRPREKTV-HQN-GYDPYA-KEFGINISEKLTSVEARVLPAPGQWN--MVNKKVSHWACINFSQELAQVAKALKHVE-LLLAILPD--NIKRICETDLGLISQCC-QYLANVSLKINVKMGGRNTVLDIPTIIFGADVTHPTGE-DPSIAAVVAVTKYAGLVCAQARQEL--IQDLELLISFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFSADEMQTLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRARFYMELPA-VK Brassica_rapa_BrAGO1 GKRC-IVKANHFFAELLHQYDVMKQLAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPTGRSFYSLGDGLRGFYQSIRPTQGLSLNIMS-STAFIELPVTEFVCEKALRGVKVEVTHRKYRISGLTAVATRESVVEYFLPCLQVGN-SNR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPQERTV-GLN-DYDPYA-KEFGIKISASLASVEARILPPPGQWN--MMNKKVSNWICVNFSQELAQVEKVLKTRD-LLIVILPD--NLKRICETELGIVSQCC-QYMANVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAITKYAGLVCAQARQEL--IQDLELLIAFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFSADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPP-LK Brassica_rapa_BrAGO10 GTKC-IVKANHFLADLLSHYDIIAELAYDGRKSLYTA-GEL-PVAIK-FV-A-RANMPQEALQILD-IVLRELSVGRSFFSLGEGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIEFVAQKGLRGVKVEVTHRKYRVAGLTTQPTRESVIEYFLPCLQVGN-QKK-AYLPMEACKIVEGQRYTKRTALLKVTCQRPRDRTV-QHN-AYDPYA-KEFGMNISEKLASVEARILPAPGQWN--MMNKKVSRWACVNFSNELGQVEKALKHVE-LLLAILPD--NLKRICETELGLISQCC-QYLANVSLKINVKMGGRNTVLDIPTIIFGADVTHPNGE-EPSIAAVVAVTKYAGLVCAQARQEL--IQDLDLLISFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFIVVQKRHHTRLFS-GNILPTVVDTKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRARFYMELPA-LK Brassica_rapa_BrAGO2a VRRV-NLLVNHFQVNIIRHYDVRDKLAYDGQKNIFSA-AEL-PFTIN-RV-N-ELKLPRDVLQGMD-VVMKEHPSGKSFFTLGYGIKGYRHTLKPTQGLSLCLYS-VLAFRKMSVIEYLKLKELTGLKVTVTHQKLTIVGLSREDTKDSIVEYFIPCLDLGK-NGR-QLVPMEFCALVEGQIYPKDLWLKKLSLVNPRQRMI-KSKEGPGEIT-GNFGMKVDTNMTRVEGRVLKAPNQWN--LMRKGVKHWAVLDFTNNLINLEELLRSVT-LILCAMTG--RLKWIAETKLGLVTQCF-QYRANLALKINAKVGGSNVELDDQVMFIGADVNHPSRD-KPSIVAVVGANRYAARVIAQPRKEE--IQGFELVKAHRPNKIVIF-RDGVSDGQFDMVLNVELLDVKLTFPKITVIVAQKRHQTRFFK-GNVPSTVVDTKVIHPFEYDFYLCSHHGGGTSKPTHYYTLWDEFTSDQVQKLIFEMCFTFTRCTKPVSLVPPVYYADMVAYRGRMYHEIFK-LH Brassica_rapa_BrAGO2b VRRV-NLLVNHFRVHIIKHYDVRDKLAYDGQKNIFSA-AQL-PFTIK-QV-N-ELMLPRDVLQGMD-VVMKEHPSGKSFFTLGFGLKGYRHALKPTAGLSLCLYS-VLAFRKMSVIEYLKHMELTGLKVTVTHQKLTIVGLSRKDTKDSIVEYFIPCLDLGK-NGR-QLVPMELCILVEGQVYPKELWLKTLSLVNPQQRMI-ESNDGPGEII-GNFGMKVDTEMTPVVGRVLKAPNQWN--LMKKGVKHWAVLDFTGLLINLEDLLRQVT-LVLCAMSG--RLKWIAETKLGLVTQCF-QYLANLALKINAKVGGSNVELEDEVMFIGADVNHPARD-TPSIVAVVGANRYAARVIAQPRKEE--IQGFELVKAHRPNKIVIF-RDGVSDGQFDMVLNRELLDVKLTFPKITVIVAQKRHQTRFFK-GNVPSTVVDTKVIHPFEYDFYLCSHHGGGTSKPTHYYALWDEFTSDQMQKLIFDMCFTFTRCTKPVSLVPPVYYADMVAFRGRIYHEIFK-LH Brassica_rapa_BrAGO4 GQKI-QLLTNHFGVKVFYHYSVLDKVAYDGEKTLFTF-GAL-PVEIS-YA-A-KIPLSQEAIRVLD-IILRQHAARQSFFHVGGNIRGFHSSFRTTQGMSLNMVT-TTMIIKGPLVDFVIARTLKNLRIKVSPQEYRITGMSDKPCRETVYDYFLPCVNVGR-PKR-PYIPLEHCTLIPLQRYTKASALVEKSRQKPQERAL-KVS-NYEPLL-RSCGISISSNFTQVEGRVLPAPGRWN--FNNKQIDKWAVANFSDDLIRVEKMFEEIQ-FLLCLLPE-RKWKKKNLTEYGIVTQCM-QYLTNCLLKINAKLGGLNSMLKVPTIILGMDVSHGPGQ-SPSIAAVVSVSKYRASVRTQPKAEM--IESLELLVDFKPEHIIIF-RDGVSESQFNQVLNIELDQIIEACPKFLLLVAQKNHHTKFFP-DNVPPTIIDNKICHPKNNDFYLCAHAGMGTTRPTHYHVLYDEFSPDELQELVHSLSYVYQRSTTAISVVAPICYAHLAAAQLGTFMKLPK-LK Brassica_rapa_BrAGO5 GKKV-TIRANHFLVQVLYHYDVMTTLAYDGRKSLYTA-GPL-PVAIK-LA-S-RPDLPYETIQVLD-VVLRDLPSGRSFFDLGDGVSGYFQSLRLTQGLSLNIVS-ARSFYEILVTEFIGKKALKSLKVELAQRSVKVSGISSCPISETVVQYFLPAIQSGS-DSR-PYFPMELCRIAEGQRYTKKTALLRATCQRPDIRMV-KNN-KYIDLVRKEFGMSVTDQLATVEARVLPPPGQWN--MIDKKVASWTSVCFSKQLIDIEEALCDIQ-MLIVILPD--VIKRICETELGIVSQCC-QYMENVALKINVKTGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAITKYRGLVSAQTREEI--IEDLEHLIAFKPLRIIFY-RDGVSEGQFSQVLLHEMTAIRKACPPVTFVVVQKRHHTRLFS-GNIQPTVVDTKICHPTEFDFYLNSHAGIGTSRPAHYHVLVDEFTADALQMLTNNLCYTFARCTRSVSIVPPAYYAHLAAFRARYYMELPA-TK Brassica_rapa_BrAGO6 GRRI-QLCTNHFNVSVFYQYTLIDQLAFDGEKTLYTV-GPL-PVQIH-FS-A-KIPLTQDAVRVLD-IVLRQQAARQAFFLVGGGVRGFHSSFRPTDGLSLNIVS-TTMILKGPVIEFLKAKVLKNLRVKASHMEFKIIGLSAKPCNQTVYEYFLPCLDVGK-PDR-PYLPLEFCNLVSLQRYTKAALLVEKSRQKPLERAM-HTY-CYDPFL-AGSGISIEKQMTLAEGRVLNPPGRWN--FNKKMIKNWAVVNFSRELISVEKMIAKMH-FILCVLPE-RKWKKVCLTEAGINTQCI-QYLTNVLLKINSKLGGINSLLKIPTLILGMDVSHGPGR-APSIAAVVGISRYRAAVRTQSKMEM--IDSLELFVEFKPKQIIIF-RDGVSESQFNQVLNIEVDQIIKAYPKFTVIVAQKRHHTKLFH-ENVPATVVDTKIVHPTNYDFYMCAHAGIGTSRPAHYHVLLDEFSPDELQNLIHSLSYVNQRSTTATSIVAPVRYAHLAAAQFAQFTKLPR-LH Brassica_rapa_BrAGO7 GSVI-YLLANHFLVKFIYHYNIKQKLAFDGRQNMYSP-VEF-QVSMR-LV-S-KFDGPQEYIHALD-VILRENPTGRSFYSIGGGSRGFFQSLRQTQGLALNILS-IAAFHEIGVIAYLQKKALKNIRVFVCHQRYRVFGLTEEITESRVMSYFLPCLQISR--TR-PYLPMELCVICEGQKFLGKAKIMQMGCQRPNERVM-SGPVGPGKQT-REFNLEVSREMTLLKGRVLQPPRPRS--L------RWALMSIGHELTQLELKLKEIQ-LIICVMER--KLKRIAETKIGVVTQCC-QFVSNLALKINAKIGGTMSELDEPVIFMGADVTHPPFD-DPSVAAVVGANRYVSRMRSQTRQEI--IQDLELLEDFLPNRIIFF-RDGVSETQFKKVLQEELQSIKAACPTITFAVVQKRHHTRLFH-ENIPPTVVDTVITHPKEFDFYLCSHLGVGTSRPTHYHILWDEFTSDELQRLVYNLCYTFVRCTKPVSIVPPAYYAHLAAYRGRLYIELPK-LS Brassica_rapa_BrAGO9a GQRI-PLLTNHFKVNFFFHYSILDKVAYDGEKTLFTV-GPL-PVEIS-YA-A-KIPMLQDAIRVLD-VILRQSAARQSFFHIGAGVRGFHSSFRTTQGLSLNITS-TTMVVQGPVVDFLLARVLKNLRVKVAPREYKISGLSENRCKETVFEYFFPCINVGK-PKR-PYIPIEHCELVSLQRYTKSASLVEKSRQKPLERGL-KNS-NYDLVL-QESGVSIGSSFTHVEGRILQAPGRWN--FNNKKVTRWAVVNFSPDLIRVEKMFEQIK-FLLCILAE-RKWKKKNLAELGIVTQCI-QYLTNVLLKINAKLGGLNSLLQVPTIIVGMDVSHGPGQ-SPSVAAVVSISKYRACVRTQSKVEM--IDNLELLVDFKPDHIIIF-RDGVSESQFNQVLNIELDQMMQACPKFTVIIAQKNHHTKFFP-DNVPPTIIDSKICHPRNNDFYLCAHAGMGTTRPTHYHVLYDEFTTDDLQELVHSLSYVYQRSTTAISVVAPICYAHLAAAQMGTVMKMPK-LN Brassica_rapa_BrAGO9b GVKT-HLLTNHFRVNFFFHYSILEKVAYDGEKTLFTV-GAL-PVEIS-YA-A-RIPMLQDAIRVLD-VILRQSAARQSFFHIGGGVRGFHSSFRTTQGLSLNITS-TTMVVQGHVVDFLLVRALKNLRVQVAPREYKITGLSEERCQDTVYKYFFPCINVGK-PKR-PFIPIEHCELVSLQRYTKSASLVEKSRQRPPERGL-KKS-NYDLVL-QESGVSIGSSFTQVEGRVLPAPGRWN--FNYKKVTKWAVVNFSSDLIRVEKMFEQMK-FILCILAE-KKWKRRNLVEEGIVTQCI-QYLTNVLLKINAKLGGLNSLLQVPTFIVGMDVSHGPGQ-SPSFAAVVGISKYRACVRTQSKVEM--IDNLELLWDFKPEHIIIF-RDGVSESQFNQVLNIELDQMMQACPKFTVIIAQKNHHTKFFP-GNVPPTIIDSKICHPRNNDFYLCAHNGMGTTRPTHYHVLYDEFSTDDLQELVHSLSYVYQRSTTAISVVAPVCYAHLAAAQMGTVMKMPK-LN Brassica_rapa_BrAGO9c GVRT-PLLTNHFRVNFFYHYSILEKVAYDGHKNLFTI-GAL-PVEIS-YA-A-RIPMIQDATRVLD-VILHQNAARQSFFHIGGGVRGFHTSFRTTQGLSLNITS-TTMVVQGPVIDFLLARALKNLRVKVVPRECKITGLSEERCKYTVYNYFFPCINVGK-ANR-PYIPIEHCELVSLQRYTKSASLVENSRQSPPERSM-KKS-NYDLVL-QESGVSIGSSFIQVEGRVLPAPGRWN--FNKKKVTRWVVVNFSSDLIRVEKMFEQIK-FILCILAE-KKWKKKNLIEHGIVTQCI-QYITNVLLKINAKLGGLNSLLQVPTFIVGMDVSHGPNQ-APSIAAVVGISKYRACVRTQSKMEM--IDNLELLFDFRPEHIIIF-RDGVSDSQFNQVLNIELDQIMQACPKFTVIIAQKNHHTKFFT-ENVLPTIVDSRICHPHNNDFYLCAHAGLGTTRPTHYHVLYDEFSTDDLQELVHSLSYVYQRSTTAISVVAPICYAHLAAAQMGTVMKMPM-LN Brugia_malayi_BmaAGO2 GRAI-VLRANHFAVRIIQHYSIVNTMVYDGKRNMYTR-DPL-PVAIK-WV-S-TVSLPFESVQAMD-VILRHLPSGRSFFSLGGGRFGFHQSVRPSQKMMLNIVS-ATAFYRMPVIEFIAEKEIRGLKIEITHRKYRVCNVTRRAAQVTVTKYFLPCLQVGQ-EQK-HYLPPEVCNIVPGQRCIKKSTMIKATARSAPERLV-RKA-EFDPFA-HEFGIAINPAMTEVKGRVLNAPGVWD--MRGKQVKVWAIACFATQLQRVEPMFKYLQ-LVCVVLPG--KVKRVGDTVLGIATQCV-QTLSNLCLKMNVKLGGVNSILTEPVIFLGCDITHPAGD-SPSIAAVVGPSRYAATVRVQARQEI--ISDLELLIQFKPTRIIIY-RDGVSEGQFFNVLQYELRALRECCPGITFIAVQKRHHTRLFA-FNIPPTTVDVGITHPTEFDFYLCSHAGIGTSRPSHYHVLWDDLSADELQQLTYQMCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVAVQ-VH Capsella_rubella_CrbAGO1 GKRC-IVKANHFFAELLHQYDVMKQLAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPTGRSFYSLGDGLRGFYQSIRPTQGLSLNIMS-STAFIESPVINFVCDKALRGVKVEVTHRKYRISGLTAVATRESVVEYFLPCLQVGN-SNR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPLERTV-ELN-NYDPYA-LEFGIKISTSLASVEARILPPPGQWN--MMNKKVNNWICINFSQELAQVEKVLKTRD-LLIVILPD--NLKRICETELGIVSQCC-QYMANVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAITKYAGLVCAQARQEL--IQDLELLIAFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Capsella_rubella_CrbAGO10 GTRC-IVKANHFLADLLNQYDIIAELAYDGRKSLYTA-GEL-PVAIK-FV-A-RANMPQEALQILD-IVLRELSVGRSFFSLGEGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIEFVAQKGLRGVKVEVTHRKYRVAGLTTQPTRESVIEYFLPCLQVGN-QKK-AYLPMEACKIVEGQRYTKRTALLKVTCQRPRDRTV-QHN-AYDPYA-KEFGMNISEKLASVEARILPAPGQWN--MMNKKVSRWACVNFSNELGQVEKALKHVE-LLLAILPD--NLKRICETELGLISQCC-QYLANVSLKINVKMGGRNTVLDIPTIIFGADVTHPNGE-EPSIAAVVAVTKYAGLVCAQARQEL--IQDLDLLISFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFIVVQKRHHTRLFS-GNILPTVVDTKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGIQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Capsella_rubella_CrbAGO2 VRRV-NLYVNHFRVHFIRHYDVRDKVAYDGQKNIFSA-AEL-PFTIK-QV-N-ELKLPRDVLQGMD-VVMKEHPSGKSFFTLGFGVKGYRHTLKPTQGLSLCLYS-VLAFRKMSVIEYLKLRELTGLKVIVNHQKLTIVGLSLQDTKDSIVDYFIPCLDLGK-NGR-QLVPMEFCDLVEGQIYPKDLWLKKLSLVNPQQRMI-KSRNGPGEII-RNFGLKVDTNMTHVEARVLKAPNQWN--LMKKGVKHWAVLDFTDNLIDLEELLQSVT-LVLCAMSG--RLKWIAETKLGLVTQCF-QYRANLALKMNAKVGGSNVELEDEVMFIGADVNHPARD-KPSIVAVVGANRYAARVIAQPRKEE--IQGFELVKAHRPNKIVIF-RDGVSDAQFDMVLNVELLDVKLTFPKITVIVAQKRHQTRFFK-GNVPSTVLDTKVIHPYEYDFYLCSHHGGGTSKPTHYYTLWDEFTSDQVQKLIFEMCFTFTRCTKPVSLVPPVYYADMVAYRGRMYHEIFK-LH Capsella_rubella_CrbAGO3 VRRV-NLLVNHFKVNFISHYDVKEKAAYDGQNNIFSA-TNLPPFTMK-KV-N-ELKLPREVLQGLD-VVMKEHPSGKSFFSRNGGFQGFRHALKPTVGLSLCLSS-VMAFYPLLVIEYLRWKELKGLKVSVSHPRFTIKGLSVQNTKDSIVNYFLPCLDLGK-NGR-QLVPMELCFLVEGQIYPKENWLRNLSIVHPEKRMI-TSPDGPGDII-GKFGLQVDTNMTHVVGRVLEPPNQWS--LMKKRVEHWAVLDFTDKLIELEELLQSVT-LVLCAMSW--RLKWIAETKLGLVTQCF-QYLANLALKMNAKTGGNNFHLEDEVMFIGADVNHPARD-EPSIAAVVGANRYASRVISQARQEE--IQGFELVKAHRPNKIVIF-RDGVSDAQFDMVLNVELRDVKLSFPKITVIVAQKRHQTRFFK-GNVPSTVVDTEVIHPSKRDFYLCSHHGGGTSKPTHYYTLWDEFTSDQIQKLIFEMCFTFTRCTKPISLVPPVKYADMVAYRGRFYYDVFK-VN Capsella_rubella_CrbAGO4 GQKI-PLLTNHFKVDVFFHYSILDKVAYDGEKTLFTY-GAL-PVEIS-YA-A-KIPLSQEAIRVLD-IILRQHAARQSFFHVGGNIRGFHSSFRTTQGMSLNMVT-TTMIIKGPVVDFLIARTLKNLRIKVSPQEFRITGLSDKPCKETVADYFLPCINVGK-PKR-PYIPLELCALIPLQRYTKASALVEKSRQKPQERAL-KVS-NYEPLL-RSCGISISSNFTQVEGRVLPAPGRWN--FNNKQIERWVVVNFSDDLIKVENMFKDIQ-FILCVLPE-KKWKKKNLTEYGIVTQCM-QYLTNLLLKINAKLGGLNSMLKVPTIILGMDVSHGPGQ-SPSIAAVVSVSKYRASVRTQPKAEM--IESLELLVDFKPEHIIIF-RDGVSESQFNQVLNIELDQIIQACPKFLLLVAQKNHHTKFFP-DNVPPTIIDNKICHPKNNDFYLCAHAGMGTTRPTHYHVLYDEFSPDELQELVHSLSYVYQRSTSAISVVAPICYAHLAAAQLGTFMKLPK-LK Capsella_rubella_CrbAGO5 GRKI-TVRANHFLVQVLYHYDVMKALAYDGRKSIYTA-GAL-PVAIKQVA-S-RPDLPYDVIQLLD-VVLRDQPSGRSFFSLGDGVRGYFQSLRLTQGLSLNIVS-ARSFYEIVVTDFISKKVLKTVKVKLLHKTAKITGISTCPISQTVVQYFLPAIQTGN-DSR-PYIPMELCQIVGEQRYTKRTALLKATCQRPEERLV-VGN-KYSPLV-KEFGMSVTSQLASIEARVLPPPGQWN--MINKKVDRWTCVNFSYQLTEIEEALHDIQ-LLIVILPD--VIKRICETELGIVSQCC-QYMENVALKINVKTGGRNTVLDRPTIIMGADVTHPPGE-DPSIAAVVAITKYRALVSAQAREEI--IQDLEHFIAFIPSRIIFY-RDGVSEGQFNQVLFHEMNAIRKACPRVTFVIVQKRHHTRLFS-GNILPTVVDTQICHPNEFDFYLNSHAGIGTSRPAHYHVLYDEFSADAMQTLTNNLCYTYARCTKAVSIVPPAYYAHLAAFRARYYMELPA-VK Capsella_rubella_CrbAGO6 GNPI-ELCTNHFNVSVFYQYTLMDQLAYDGEKSLYTV-GPL-PVQIH-FV-T-KIPLAQDALRVLD-TVLRQQAARQAFFHIGGGARGFHSSFRPTHGLSLNIVS-TTMIVEGPVIEFLKAKMLKNMRVKASHMEFKIIGLSQKPCNQTVYDYFLPCLDVGK-PNR-PYLPLEFCNLVSLQRYTKAASLAEKSRQKPLDRAM-HT---YDPFL-AGCGISIEKQMTQVEGRILKPPGRWN--FNNKMIKNWAVVNFSRELISVEKMIAKMH-FILCVLPE-RKWKKICLTDEGINTQCI-QYLTNVLLKINSKLGGINSLLKIPTLILGMDVSHGPGR-APSVAAVVGISRYRAAVRTQARLEM--IDSLELFVEFKPKQIIIF-RDGVSGSQFNQVLNIEVDQIIKAYPKFTVIVAQKKHHTKLFP-ENVPATVVDTKIVHPTNYDFYMCAHAGIGTSRPAHYHVLLDEFSPDDLQNLIHSLSYVNQRSTTATSIVAPVRYAHLAAAQFAQFNRLPR-LH Capsella_rubella_CrbAGO7 GSVI-YLLANHFLVKFIYHYNIKQKLAFDGRKNIYSP-VEF-QVNMR-LV-S-KFDGPPEYIHALD-VILRENPMGRSFYSIGGGARGFFQSLRHTQGLALNMLS-ITAFHEIGVIAYLQKKALKNIRVFVCHQRYRVYGLTEEITENRLMSYFLPCLQISR--AR-PYLPMELCMICEGQKFLGKAKIMKMGCQKPNERVM-AGSVGPGNQT-REFNLEVSKEMTLLKGRILLPPRPKN--LKESRIERWALMSIGNELTQLESKLKEIQ-LLICVMEK--KLKRIAETRIGVVTQCC-QFVSNLALKINAKIGGSMTELDEPVIFMGADVTHPPFD-DPSVAAVVGANRYVSRMRSQTRQEI--IQDLELLDDFLPNRIIFF-RDGVSETQFKKVLQEELQSIKAACPSITFAVVQKRHHTRLFS-ENIPPTVVDTVITHPNEFDFYLCSHLGVGTSRPTHYHILWDEFTSDELQRLVYNLCHTFVRCTKPISIVPPAYYAHLAAYRGRLYIELPK-LS Capsella_rubella_CrbAGO8 GRKI-NLLTNHFSVDFFFHYSILEKVAYDGDKSLFTV-GPL-PVAIS-FA-A-KIPMIQDMIRAMD-VILGQNAARQSFFYVGEGVKGFHSSFQNTQGLSLKIVS-TTMIIKGAVVDFLIESALKNLRVKVIHREYKITGLSELRCKDTVFDYFLPCINVGK-PNRPPYFPIELCELVSLQRYTKASNLVKEARQKPQQNAC-KNS-NYDPML-QDCAVRIGSGLTQLHGRVLPTPGSWN--FIDKKVTRWAVVNFSRELIRVDKMFEYLK-FLLCIL-E-KKWKKKNLVQFGIVNQCI-QYLINVLLKINAKLGGLNSILRVPTIIIGMSISHGPGQ-SPSIAAVVSISKYKACVRTQTKAEI--IENLELLLDFKPNHIIIF-RDGVSESQFNRVLNIELDQMM-----------QKNHHTKFFP-DNVPPTIVDSNICHPRNNDFYLCAHAGKGTTRPTHYHVLYDEFNTDNLQELVHSLSYVYQRSTSAISLAAPICYAHLAASQMATAMKMPK-LN Capsella_rubella_CrbAGO9 GQKI-PLLTNHFGVKFFFHYSILDKVAYDGEKTLFTV-GAL-PVEIS-YA-A-KIPMLQDAIRVLD-IILRQSAARQSFFHIGGGVRGFHSSFRTTQGLSLNITS-TTMIVQGPVVDFLLARVLKNLRVQVTLREYKISGLSEQSCKDTVLDYYFPCINVGK-PKR-PYFPIEFCNLVSLQRYTKSAALVEKSRQKPPERGL-KDS-NYDPVL-QDSGVSIISDFTKVEGRILPTPGRWN--FNNKKVTRWAVVNFSRDLIRVENMFEQIL-FLLCILSE-RKWKKKNLVDLGIVTQCI-QYLTNVLLKINAKLGGLNSLLQVPTIIVGMDVSHGPGM-SPSIAAVVSISKYKACVRTQSKMEM--IDNLELLLDFKPEHIIIF-RDGVSESQFNQVLNIELDQMMQACPKFTLIVAQKNHHTKFFP-NNVPPTIIDSQICHPRNNDFYLCAHAGMGTTRPTHYHVLYDEFATDDLQELVHSLSYVYQRSTTAISVVAPICYAHLAAAQMGTVMKMPQ-LN Carica_papaya_CpAGO1 GTKC-VVKANHFLAQMLFHYSIMTQLVYDGGRNLYTA-GFL-PVTIK-FV-A-VASMPQEAINVID-IVLRELAAGRFLYSLGGGLRGFYQSIRPTQGLSLNIMS-TTAFIELPVIEFVAKKALRGVKVEVTHRKYRISGLTSQPTRESVVEYFLPCLQVGN-PRK-IY?????????????????TSLLKVSCQRPCEQTI-RQN-AYDPYA-KEFGINIDSKLASIEARVLPPPGQWN--MMNKKVRYWACINFSQQLVQVKKALKYVE-LLIAILPD--NLKRICETDLGLISQCC-QYLANLSLKINVKMGGRNTVLDIPTIIFGADVTHPTGE-DPSIAAVVAVTKYAGLVCAQPRQEL--IQDL---------------RDGVSEGQFYQVLLFELDAIRKACPPVTFVIVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADEIQTLTNNLCYTYARCTRSVSVVPPAYYAHLAAYRARFYMELPA-LK Carica_papaya_CpAGO10 GTKC-IVKANHFFAELLNQYDIIAELAYDGRKSLYTA-GEL-PVVIK-FV-A-RANMPQEALQILD-IVLRELSNGRSFFSLGEGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVVEFVAQKALRGVKVEVTHRKYRVAGLTSQPTRESVVEYFLPCLQVGN-QKK-AYLPMEACKIVEGQRYTKRTSLLRVTCQRPRDRTV-QHN-AYDPYA-KEFGIKISEKLASVEARILPAPGQWN--MMNKKVTRWACINFSHELAQVEKALKHVE-LLLAILPD--NLKRICETDLGLISQCC-QYLANVSLKINVKMGGRNTVLDIPTIIFGADVTHPNGE-DPSIAAVVAVTKYAGLVCAQARQEL--IQDLDLLVSFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFIVVQKRHHTRLFS-GNILPTVVDSKICHPSEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGMQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRARFYMELPA-LK Carica_papaya_CpAGO2 IHTA-RLRVNHFLVKFIMHYDIRKKLAYDGEKNIYSL-VPL-ECTIK-LV-N-ELKLPRDILQGMD-VVMKENPTGRGFHFLGFGLRGYRHSLKPTSGLALCVYS-VLAFWKMPVIEFLKQNALTNLKVTVTHQKYTIVCLTKERTKNSIVDYFIPCLDLGK-NNR-AYVPMEFCVLVEGQIYPKEWRLKNMSLAKPEDRIV-GATDGPGYGI-RNFGIEVDVNMTSVIGRIIRPPCQWN--LLGKGVERWAVLDFSPKLINLYELLESVQ-FILCVMSR--KLKWISETRTGVVTQCC-QYLANLALKINAKLGGSNVELEDHVMFVGADVNHPARN-TPSIAAVVAANQYAARIRAQNREER--IVNYDLAETYKPKKVVVF-RDGVSEGQFDMVLNEELLDMKDAFPNITIVVAQKRHQTRFFT-GNIPPTVVDTKIIHPFEFDFYLCSHYGSGTSKPTHYHVLWDEFSSDQLQKLIYDMCFTFARCTKSVSLIPPVYYADLVAYRGRLYHEFYK-VH Carica_papaya_CpAGO4 GQKI-QLLTNHFKVNVFYHYSLIDKVAYDGEKSLFSA-GPL-PVEIS-FA-A-KIPMSQEALRVLD-IILRQHASRQSFFHVGGGVRGFHSSFRASQGLSLNIVS-TTMIIRGPVVDFLIERTLKNLRIKANPQEYKITGLSERPCKETVYDYFLPCINVGK-PKR-PFIPLELCSLVPLQRYTKAASLVEKSRQKPQERAL-RNS-NYEPML-RQCGISISTNFTQIEGRVLPAPGRWN--FNNKKIERWAVVNFSRDLIKVEKMFEEIE-FLLCLLPE-RKWKRKNLAEFGIVTQCI-QYLTNVLLKINAKLGGLNSILKAPTIILGMDVSHGPGQ-SPSIAAVVSISRYRASVRTQSKVEM--IDSLELLLDFKPDQIIIF-RDGVSESQFNQVLNIELDQIIEACPKFLVIIAQKNHHTKFFP-DNVPPTVIDSKICHPRNNDFYLCAHAGMGTTRPTHYHVLLDEFSADDLQELVHSLSYVYQRSTTAISVVAPVCYAHLAATQMGQFIKLPR-LK Carica_papaya_CpAGO5 GYKC-QIRANHFLVEFLFQYDVIEELAYDGRKFLYTA-GAL-PVALK-LA-G-KADLPYETIQALD-IVLRQMASGRSFFSLGDGVWGHYQSLRPTQGLSLNILS-ATAFYQILVTDFLKERALKLLKVSLTCRAYKIFGISDQPLSESVVQYFLPAIQAGS-VSS-PFLPMEVCQIADRQRYTKKTNLLRATCRRPNQRIA-QSV-KFDALVTTEFGIHVGRELAKVEARVLRSPGQWN--MINKKVEFWTCVNFSRQLIEIERVLVDIQ-LLIVILPD--VIKRVCETELGIVSQCC-QYFENIALKINVKAGGRNTVLDRPTIILGADVTHPPGN-DPSIAAVVAATKYRGIVSAQSREEI--IQDL------------------------------------RACPPVTFIVVQKRHHTRLFS-GNILPTVVDTKICHPREFDFYLNSHAGIGTSRPVHYHVLWDEFTADALQVLTNNLCYTYARCTRAVSIVPPAYYAHLAAFRARYYLELPS-IK Carica_papaya_CpAGO6 GNRI-PLLSNHFKVSVFYQYTIMDRLAYDGGKSLYTV-GPL-PVEIR-YA-A-KIPLTQDALRVLD-IVLKQKAARQSFFHLGGGVRGFHSSFCTTQGLSLNTVS-TTMILKGPVIDFLLFSPYKEHRW-------------------------------GK-S-----LAIE-CKLLLMLRFLTFCSSESCNALTPLN-AV-GNN-HHEVVL-TECGISIDRQLMQVDGRILETPGRWN--FNNKTIDSWLVVNFSRELISVDRMFEQMK-FILCVLPE-RKWKKKCLCDYGIVTQCI-QYLTNVLLKINSKLGGINSLLDIPTMILGMDVSHGLGQ-LPSIAAVVGISRYRASVRTQSKMEM--IDALELLVDFKPKQIILF-RDGVSESQFNQVLNIEVEQIIKAYPKFTVIVAQKNHHTKLFN-DNVPPTIVDTKIVHPRTYDFYLCAHAGMGTSRPAHYHVLIDEFNPDDLQNLIHSLSYVYQRSTSAISIVAPVYYAHLAAQQISQFLKLPR-LA Carica_papaya_CpAGO7 GPVI-SLLANHFLVQFIYHYNIKQKLAYDGRKNLYSP-IEF-QINIR-LV-S-KLDGPQDYLHALD-VVLRESPTGRSFYSIGGGARGFFQSLRPTQGLALNVFS-VTAFHEIGVIPYLQKKALRNIRVFVCHQRYRVYGLTEEATENRLLTYFLPCLQISR--SK-PYLPMELCMICEGQKFLGKARILKMACQRPKERVM-GGPVGPGNQG-REFKFNVSREMTRLSGRILQPPRQWN--LLDSHIERWALISFGNQLSQLESKLKKIQ-LLMCIMER--KLKRIAETSVGVVTQCC-QFLANLALKMNAKVGGCTVALDEPVMFMGADVTHPPLD-DPSVAAVVGANKYVSRMRSQTRQEI--IQDLELLDDFLPKRIIFF-RDGVSETQFNKVLKEELQAIREACPPITFSVVQKRHHTRLFE-ENIPPTVVDTVITHPREFDFYLCSHWGVGTSRPTHYHVLWDEFTSDELQKLVYNLCYTFVRCTKPVSLVPPAYYAHLAAYRGRLYLELPK-LR Chlamydomonas_reinhardtii_CrnAGO2 GKTI-QVLTNHVPLNVVHQYDVLVALVFDGSQALYG-------VDLK-LV-G-ALDVGAAALAVLD-LVTRAGVAGGSYVSASGPVRGFRSAVAQVAGTTLTIAA-SAVVAGGPLLGQLQAEALVGLEVQPSYNRYKLSGKLGKSARSSV----LPCVL----DKK-GALPIELLTVVKYQKRMSRADYIRTAALKPADRAL-TRQLGSGQVA-RAFGLAPFNDMLKVPAQLLPGPGEWA----GGGWRSGAVLCYLAALSKAEFWLNRAQ-MVMVVLPD-RGIKAAGDGKLGVATQCV-SYAAQLALSVNAKLGGATTRPGRRLMVSGALLSRGAAQVSVEYAAVVGAVDYRVQLSAQVNRDI--VVSM---------VVLMY-RDGLSESQFDRALAEEFTAIVQACPRICFVVVQKSHNTRFFS-GNVLPTAVDRGVTDPHAFDFFLNSHAGIGTNRAPRYTVLVDEFTAEALQLLTHTLCHTYPACTRALSLPPPVRYADRAADRARTLRYLPT-LP Chlamydomonas_reinhardtii_CrnAGO2like GKTI-QVLTNHVPLNVVHQYDVLVALVFDGSQALYGVEGDL-RVDLK-LV-G-ALDVGAAALAVLD-LVTRAGVAGGSYVSASGPVRGFRSAVAQVAGTTLTIAA-SAVVAGGPLLGQLQAEALVGLEVQPSYNRYKLSGKLGKSARSSVQTYFLPCVL----DKK-GALPIELLTVVKYQKRMSRADYIRTAALKPADRAL-TRQLGSGQVA-RAFGLAPFNDMLKVPAQLLPGPGEWA----GGGWRSGAVLCYLAALSKAEFWLNRAQ-MVMVVLPD-RGIKAAGDGKLGVATQCV-SYAAQLALSVNAKLGGATTRP---------ALPRTRVQVSVEYAAVVGAVDYRVQLSAQVNRDI--VVSMRLLLQYLPEVVLMY-RDGLSESQFDRALAEEFTAIVQACPRICFVVVQKSHNTRFFS-GNVLPTAVDRGVTDPHAFDFFLNSHAGIGTNRAPRYTVLVDEFTAEALQLLTHTLCHTYPACTRALSLPPPVRYADRAADRARTLRYLPT-LP Chlamydomonas_reinhardtii_CrnAGO6 GKAV-ALLANYFALATAYHYDVMASARFDGRKNLFLP-GELLPVTTK-WA-A-CVGLPRDAMQVLD-IVIRHAFAGRGFYYLGGGASGFQQSFKAVQGLTLNLSS-FAAFMSRPLPELLAE----GAGVEFPMRRKALVGLSEQGADRSVAEYFLPCANVGD-RRR-AFIPVELCTVVAGQRRMK-AGMITAAKQDPAVKQAKRVAEALGGTD-RCWGLKLATGMLPVQGRMLPNP--------NVKLDSWGVAVMMEDLTGIEATMRAAQ-LVLVVLPE--KVKRVSDIELGIPSQVV-QYCANVAMKINNKLGGVNVQLAVPFMVLGADVTHPRAD-SPSVAAVVALGRWASRVLLQARQEV--ITGMELLLEFKPQRLVMY-RDGVSEGQFEQVLAEEYTALRRACPAITFVVVQKRHNTRLLK-GNVVPTVVDSGITAPDGFDFYLNSHAGLGTNKPAHYHVLVDEFGADGIQLLTYWLCYLYQRTTKSVSYCPPAYYADRAAFRGRTLLAFAG-IH Chlamydomonas_reinhardtii_CrnAGOlike GQSA-LPCTSAAAAPAATQSSVLDSARVELASSVTRP-SPI-PITTG-ATGS-ETSLAADVQRYLDQAAAAHAAAGECDFSISHRVRGGDAANKPAGGASASDAGAAAAVPSQPLWDAQVPVPMQGLQMQQPW-QHEVEAMAEATAEALLANYFVEEAAGGE------LLPREVVTLKPREGDKSEDYLAQRQQTAPRDAAAKRVAEALGGTE-RSWGLKLGTGMLPVQGRVLPNPGSWN--TLNVKLDSWAVAVMM-------------Q----------AA-----------------QYCANVAMKINNKLGGVNVQLSVPFMVLGADV--------------------------------------------KPQRLVMY-RDGVSEGQFEQVLAEEFTALRRACPAITFVVVQKRHNTRLLK-GNVVPTVVDSGITAPDGFDFYLNSHSGLGGG------------------------------------------------------------FQ Citrus_sinensis_CsnAGO1 GTRC-IVKANHFFAELLHQYDVMEQLAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPTGRSFYSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVQQKALRGVRVEVTHRKYRISGLTSQTTGESVVEYFWPCLQVGN-QQR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPHERTV-HHN-AYDPYA-REFGIKISEKLASVEARILPAPGQWN--MMNKKVNHWICINFSFELAQVEKVLKTRD-LLIVILPD--NLKRICETDLGLVSQCC-QYMANVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAVTKYAGLVCAQARQEL--IQDLELLISFKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Citrus_sinensis_CsnAGO10 GTKC-IVKANHFFAELLNQYDIMAELAYDGRKSLYTA-GEL-PVVIK-FA-A-RANMPQEALQILD-IVLRELSTGRSFFSLGDGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIEFVAQKALRGVKVEVTHRKYRVSGLTSQPTRESVVEYFLPCLQVGN-QKK-AYLPMEACKIVEGQRYTKRTALLKVTCQRPRDRTV-QQN-AYDLYA-KEFGIKISEKLASVEARILPAPGQWN--MMNKKVSRWACINFSNELAQVEKALKHVE-LLLAILPD--NLKRICETDLGIISQCC-QYLANVSLKINVKMGGRNTVLDIPTIIFGADVTHPNGE-DPSIAAVVAVTKYAGLVCAQARQEL--IQDLDLLISFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFIIVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRARFYMELPA-LK Citrus_sinensis_CsnAGO4 GQRI-SLLTNHFKVNVFYHYSVIDRVAYDGEKSLFTV-GPL-PVEIS-FA-A-KIPISQEAFRVLD-IILRQHAARQSFFHVGGGVRGFHSSFRTTQGLSLNIVS-TTMIIQGPVVDFLIARTLKNLRIKTITQEYKITGLSEKLCKETVYDYFLPCINVGK-PKR-PYIPLELCELVSLQRYTKAASLVEKSRQKPQERAL-KLS-KYEPML-RSCGISISTNFAQVEGRVLPAPGRWN--FNNKKIERWAVVNFSRDLIKVEKMFDEIQ-FLLCLLPE-RKWKRKNLADFGIVTQCM-QYLTNVLLKINAKLGGLNSLLKVPTIILGMDVSHGPGH-SPSIAAVVSISRYRAAVRTQSKVEM--IDSLELLLDFKPEQIIIF-RDGVSESQFNQVLNVELNQIIEACPKFAVIVAQKNHHTKFFP-DNVPPTVVDNKVCHPRNYDFYLCAHAGMGTSRPTHYHVLFDEFSSDELQELVHSLSYVYQRSTTAISVVAPICYAHLAASQVGSFMKLPR-LQ Citrus_sinensis_CsnAGO5 ------------MVQLIHHYDIISQLAYDGMKSIYTA-GPL-PVVIR-LA-S-KPDLPYDVIQVLG-VILSAASSGRSFFPLGDGVRGYFQSLRLTQGLSLNIVS-ARSFYEILVTEFVQNKELKGIKVVLTHNSHRITGISSQPMSQSVIQYFLPALLAGS-EAR-PYLPMELSRIVAGQRYTQRTALLQATCQRPRERMA-RAN-AYDTLVNKEFGIQVADDLTSVDARILPAPGQWN--MINKKVEVWTCVNFSQGLVDIEKALVDVQ-LLIIILPD--V-------------------------RFASLVGGRNTVLDRPTIIFGADVTHPPWG-GPSIAAVVAVAKYRGLVSAQAHEEI--IQDLELLIAFKPHRIIFY-RDGVGERQFSQVLLHEMNAIRQACPPVTFVVVQKRCRTRLFS-GNILPTVVDTEICHPTEFDFYLNSHAGIGTSRPTRYHVLYDEFTADGLQVLTNNLCYTYARCTRSVSIVPPAYYAYLAAFRARYYIELPV-IK Citrus_sinensis_CsnAGO6 GRRI-SLLTNHFKVSVFYHYTVVDKLAYDGEKSLYTV-GPL-PVEIS-FA-T-KIPLTQDALRVLD-IVLRQQAARQSFFHVGGGVRGFHSSFRPTQGLSLNMVS-TTMILKGPVIDFLIAKMLRNLRVKPRHMEFKIVGLSEKPCNQTVYDYFLPCLDVGK-PKR-PYLPLELCSLVSLQRYTKAASLVEKSRQKPQDRAL-RSY-SYDPVL-AACGISIGKQLTQVDGRILEIPGRWN--FNNKRIDRWIVVNFSRELINVERMFELIQ-FILCVLPE-RKWKKKSLSDFGIATQCI-QYLTNVLLKINSKLGGINSLLDTPTMILGMDVSHGPGR-SPSVAAVVGISRYRAAVRTQSKVEM--IDALELLLDFKPKQIIIF-RDGVSESQFNQVLNIELEQIIKAYPKFTVIVAQKNHHTKLFP-ENVPPTVVDTRIVHPRNYDFYMCAHAGMGTSRPAHYHVLLDEFSPDDLQNLIHSLSYVYQRSTTAISIVAPICYAHLAASQMGQFIKLPR-LH Citrus_sinensis_CsnAGO7 GAVI-SLLANHFLVQLIFHYNIKQKLAFDGRKNIYSP-VEF-EINIK-LV-S-KYDGPQDYLHALD-VVLRENPSGRSLYSIGGGARGFFQSLRPTQGLSLNVSS-VSAFHEVGVIPYLQKRALKNIRVFVCHQRYRVYGLTEEVTENRLLSYFLPCLQISR--SK-PYLPMELCMICEGQKFLGKARILKMGCQRPKERVM-RGPVGPGNQG-REFKLHVSREMTRLNGRILQPPRQWN--FLESHIERWALLSFGCQLSQLESKLKKIQ-LLICVMER--KLKRIAETSVGVVSQCC-QFLANLALKINAKVGGCTVALDEPVIFMGADVTHPPLD-DPSVAAVVGANKYASRMRSQTRQEI--IQDLELLDDFLPRRIIFF-RDGVSETQFYKVLQEELQSIREACPPITFVVVQKRHHTRLFD-ENIPPTVVDTVITHPREFDFYLCSHWGVGTSRPTHYHILWDDFTSDELQKLVYNLCYTFVRCTKPVSLVPPAYYAHLAAYRGRLYLELPK-LS Citrus_sinensis_CsnAGO9 GTPM-TLLTNHFEVRMFCHYSILDKVAYDGEKSLFTL-GSF-QVEIS-YA-A-KIPMFQEAMRVLD-IILRQNAARQSFFHLGGGVRGFHSSFRATQGLSLNMVS-TTMIVKGPVVNFLLARVLKNLRINTNHTEYKITGLSDLPCNQTVYEYFFPCINVGK-PKR-AYIPLELCTLVSLQRYTKAASLVEKSRQKPQERAM-RRN-NYDQML-RSFGISIGTQFTQVEGRTLPAPGRWN--FNNKQIKWWAIVNFSNNLIRVERMFEIIQ-LLLCILPE-RKWKRKNLSEAGIVTQCI-QYITNVLLKINAKLGGMNSLLKPVTMILGMDVSHGPGR-SPSIAAVVSISRYRASVRTQSKVEM--IANLELFVDFKPENIIIF-RLNTLSCTFLQ---------IEASPKFTVIVAQKNHHTKFFP-ENVPPTVVDKGVCHPRNNDFYLCAHAGMGTSRPTHYHVLHDEFSADDLQELVHSLSYVYQRSTTAVSVVTPICYAHLAAAQMSQFIKLPV-LH Citrus_sinensis_CsnAGOlike GRKC-VVRANHFMVQLIHHYDIISQLAYDGMKSIYTA-GPL-PVVIR-LA-S-KPDLPYEVIQVLA-VVLRAAPSGRSFFSLGDGVRGYFQSLRPTQGLSLNIVS-ASSFYEILVTEFVQNKALKGIKVVLTHNSHKITGISSQPMSQSVIQYFLPALVAGS-EAR-PYLPMELSRIVAGQRYAKRIALLRATCQRPRERMA-RAN-AYDTLVNKEFGIQVADDLTSVDARILPAPGQWN--MINKKVEVWTCVNFSQGLVDIEKALVDVQ-LLIIILPD--VIKRVCETELGIVSQCC-QYFENVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAVAKYRGLVSAQAHEEI--IQDLELLIAFKPHRIIFY-RDGVGERQFSQVLLHEMNAIRQACPPVTFVVVQKRCRTRLFS-GNILPTVVDTEICHPTEFDFYLNSHAAIGTSRPTRYHVLYDEFTADGLQVLTNNLCYTYARCTRSVSVVPPAYYAYLAAFRARYYIELPV-IK Crassostrea_gigas_CgAGO2 GKPI-ALRANHFHVNIIHHYNIVETMVFDGREKLYSR-EPL-PVAIK-WL-S-QISLPECAVEALD-VIMRHLPSGRSFFSLGGGRFGFHQSVRPSHKMMLNIVS-ATAFYKQPVIDFMCEKEIRNLKVEITHRKYRVCNVTRRPAQTTVARYFLPCLQVGQ-EHK-HYLPLEVCNVVGGQRCIKKATMIRATAKNAPDRLV-KKA-SYDPHL-RTFGITVNPQMMDLHGRVLSHPGVWD--MRGKQIRVWAIACFAQQLQKVEPMFRYLQ-LIVVVLPG--RVKRVGDILFGLATQCV-QTLSNLCLKINVKLGGINNILREPVIFLGADVTHPAGD-TPSIAAVVGPSRYSATVRVQERKEV--IEEFELLISFKPTRIIIY-RDGVSEGQFQKVLAHELRAVREACPGITFIAVQKRHHTRLFS-GNIPATIVDVGITHPTQFDFYLCSHAGIGTSRPSHYHVLWDDFKADELQQLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVAIT-VH Cucumis_sativus_CstAGO1a GTRC-IVKANHFFAELLHQYDVMEQLAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPTARSFYSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELHVIEFVTQKALRGVKVEVTHRKYRISGLTSQATRESVVEYFWPCLQVGN-QQR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPKDRTV-HHN-AYDPYA-KEFGIKISEKLASVEARILPAPGQWN--MMNKKVNNWMCINFSYELAQVEKALKTRD-LLIVVLPD--NLKRICETDLGLVSQCC-QYLANVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAVTKYAGLVSAQARQEL--IQDLELLISFKPQRIIFY-RDGVSEGQFYQVLLHELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGLQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Cucumis_sativus_CstAGO1b GTKC-LVKANHFLAIIISHYNILTELVYDGGSNLYTA-GLL-PVQIK-FV-T-LASMPQEALTIID-IVLRELHAGRSFYSVGGGLRGFYQSIRPTQGLSLNIMS-STAFIEIPVIDFVAQKVLRGVKVEVTHRKYRISGLTSQPTRESVVEYFLPCLQVGN-QKK-VYLPMEACKILKGQRYTKGTSLLKVSCQRPSDQTV-HEN-AYDPYA-KEFRISIDNKLTSVEARVLPSPGQWN--MMNKKIRYWACINFSQQLVQVKKALKFVD-LLIAILPD--NLKRICETELGLISQCC-QYLANVSLKINVKMGGRNTVLDIPTIIFGADVTHPSGE-DPSIAAVVAVTKYAGLVCAQPREEL--IQDLELLLSFKPLRIIFY-RDGVSEGQFYQVLLHELDAIRKACPPVTFIIVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFSADEIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAYRARFYVELPA-LK Cucumis_sativus_CstAGO4 GQKI-SLLTNHFKVNVFFHYSVIDKVAYDGEKSLFTV-GPL-PVEIS-FA-A-KIPMFQEAIRVLD-IILRQNASRQSFFHVGGGVRGFHSSFRTTQGLSLNIVS-TTMIIQGPVVDFLIARTLKNLRIKASPAEYKITGLSEKPCKETVYDYFLPCINVGK-PKR-PFIPVELCSLVSLQRYTKAASLVEKSRQKPQERSL-RRN-KYEPML-RSCGIAINSSFIQVEGRVLPAPGRWN--FNNKKIERWAVVNFSRDLIKVEKMFEEVQ-FLLCLLPE-RKWKKKNLAEFGIVTQCI-QYLTNVLLKINAKLGGLNSLLKVPTIILGMDVSHGPGQ-SPSIAAVVSISRYRAAVRTQSKVEM--IDSLELLLDFKPDQIIIF-RDGVSESQFNQVLNVELDQIIQSCPKFVVIVAQKNHHTKFFP-DNVPPTIIDNKICHPRNNDFYLCAHAGMGTTRPTHYHVLLDEFSADDLQELVHSLSYVYQRSTTAISVVAPVCYAHLAATQIGQFIKLPR-LQ Danaus_plexippus_DpAGO1 GRPI-MLRANHFQISMVHHYDIVETMVFDGRNNLYTR-DPL-PVTIK-WV-A-QVSLPYDAILALD-VVMRHLPSGRSFFSLGGGRFGFHQSVRPSQKMMLNIVS-ATAFYKQPVIEFMCEKEIKGLKIEITHRKYRVCNVTRRPAQMTVAKYFLPCLQVGQ-EHK-HYLPLEVCNIVPGQRCIKKSTMIKATARSAPDRLV-RRA-NFDLYV-KEFGLTISNNMMEVRGRVLPPPGVWD--MRGKQIRVWAIACFAQQLQKVEPMFKYLQ-LVVVVLPG--KVKRVGDTVLGMATQCV-QTLSNLCLKINVKLGGINSILNEPVIFLGVDVTHPAGD-NPSIAAVVGPSRYAATVRVQQRQEI--VHEMELLIMFKPHRIIMY-RDGISEGQFIHVLQHELTAVREACPGITFIVVQKRHHTRLFS-GNIPATTVDLGITHPTEFDFYLCSHQGIGTSRPSHYHVLWDDFGSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVAIT-VH Danio_rerio_DrAGO2 GRTI-KLQANFFEMEIVYHYEIVEHMVYDGRKNLYTA-MPL-PVAIK-WM-S-CVSLPFETIQALD-VVMRHLPSGRSFFTLGGGRFGFHQSVRPSLKMMLNIVS-ATAFYKQPVIEFMCEKEIKGLKVEITHRKYRVCNVTRRPASHTVAQYFLPCLQVGQ-EQK-HYLPLEVCNIVAGQRCIKKSTMIRATARSAPDRLM-RSA-NFDPYV-REFGVMVRDDMTEVNGRVLQAPGVWD--MRNKQIKVWAIACFADQLRKVEPMFKHLQ-LVVVILPG--KVKRVGDTVLGMATQCV-QTLSNLCLKINVKLGGVNNILQQPVIFLGADVTHPAGD-GPSIAAVVGPSRYCATVRVQQRQDI--IQDLELLIQFKPTRIIYY-RDGISEGQFNQVLQHELLAIREACPGITFVVVQKRHHTRLFS-GNIPATTVDTKITHPFEFDFYLCSHAGIGTSRPSHYHVLWDDFTSDELQVLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVAVQ-IH Drosophila_immigrans_DiAGO2 GRPG-TCAVNYLDVDMAYHYDAFDMCAFDGRKSCYSV-EKL-KVTVKETLDS-IVNLPMRAMQCLE-VVLAEPCNGRSFFMLGDGYVGLYQSFVLGD-PFVNVVS-HKSFPIMKVIDYLINTFLKGINIIYEPRVYRVNGFSQQPANQTVDAYFVVCLHVGP-PAK-NYLPMELCRIEEGQALNRKSAMIKFAATSTNERLL-RHF-NHDPSI-SRFGIHISNDFITVTTRLLMPPGSWY--MERCQQHKWAILDCESLVTRLDEHFKELD-LVFVIIPS--RIKQKAELQHGILTQCI-QLVDNVLLKVNSKLNGINHKLLANVMYLGADVTHPPDQ-RPSVVGVAGGASYNMQYRLQTAREE--IDDMEHLRVYYPQHIIYY-RDGVSDGQFMKIKSIELRSIYAACPKLCCVIVVKRHHTRFFF-NNVDPTIVDRTIVHPNEMQFFMVSHQSIGTAKPTRYNVIENTLDIDLLQQLTYNLCHMFPRCNRSVSYPAPAYLAHLAAARGRVYINVPEFLK Drosophila_melanogaster_DmAGO1 GRPI-VLRANHFQVTMVHHYDIIETMVFDGRNNLYTR-DPL-PVTIK-WQ-A-QVSLPYDAILALD-VVMRHLPSGRSFFSLGGGRFGFHQSVRPSQKMMLNIVS-ATAFYKQPVIDFMCEKEIKGLKIEITHRKYRVCNVTRRPAQMTVAKYFLPCLQVGQ-EHK-HYLPLEVCNIVAGQRCIKKSTMIKATARSAPDRLV-KRA-DFDSYV-QEFGLTISNSMMEVRGRVLPPPGVWD--MRGKQIRIWAIACFAQQLQKVEPMFRYLQ-LVVVVLPG--KVKRVGDTVLGMATQCV-QTLSNLCLKINVKLGGINSILNEPVIFLGADVTHPAGD-NPSIAAVVGPSRYAATVRVQQRQEI--IQELELLIMFKPHRIILY-RDGVSEGQFPHVLQHELTAIREACPGITFIVVQKRHHTRLFS-GNIPATTVDVGITHPTEFDFYLCSHQGIGTSRPSHYHVLWDDFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVAIT-VH Drosophila_melanogaster_DmAGO2 GKPG-QVGINYLDLDLAYHYDAFEQFAYDGKASCYSV-DKL-PIEIKETGDS-TIDLPMRAMQCVE-VVLASPCHGRSFFKLDDGYVGLYQAFMLGD-PFLNVIS-HKSFPIMPMIEYLERPFLRGINVVYTPRVYRVNGLSRAPASSTIASYFLHCLNVGS-SIK-SLLPIELCSIEEGQALNRKANMIKYAATSTNVRLL-QYF-QHDPTI-SRFGIRIANDFIVVSTRVLSPPGSWR--MDGMKAHKCAVLYCDNLIISLDTIFADLD-LAIVIIPQ--FIKQKAELQHGILTQCI-QTIGNILLKINSKLNGINHKIMKNTMYIGADVTHPPDQ-RPSVVGVAAGASYNMQYRLQRALEE--IEDMEHLRVYYPDHIIYY-RDGVSDGQFPKIKNEELRCIKQACPKICCVIVVKRHHTRFFF-NNVDPTVVDRTIVHPNEMQFFMVSHQAIGTAKPTRYNVIENTLDIDLLQQLTYNLCHMFPRCNRSVSYPAPAYLAHLVAARGRVYLTVPEFMK Drosophila_santomea_DsAGO2 GKPG-QVGVNYLDIDMAYHYDAFEQFAFDGKASCYSV-DKL-PIEIKETNDS-SIDLPMRAMQCIE-VVLASPCHGRSFFKLDDGYVGLYQAFMLGD-PFLNVIS-HKSFPIMSMIEYLE?PFLRGINVVYTPRVYKVNGLSSGPASSTIAAYFLHCLHVGP-ATK-HLLPIELCAIEEGQALNRKANMIKFAATSTNVRLL-KFF-EHDPTI-SRFGIRIANDFIMVSTRTLNPPGSWR--MDNMKAHKWAILYFDRNVLGLDDVFADLD-LAFVIIPQ--SIKQKAELQHGILTQCI-QTIGNILLKVNSKLNGINHKILKNAMYMGADVTHPPDQ-RPSVVGVAAGAAYNMQYRLQRTLEE--IEDMEHLRVYYPEHILYY-RDGVSDGQFPKIKNEELRGIIQACPKLCCVIVVKRHHTRFFF-NNVDPTVVDRTIVHPNEMQFFMVSHQSIGTAKPTRYNVIENTLDIDLLQQLTYNLCHMFPRCNRSVSYPAPAYLAHLVAARGRVYLTVPEFMK Ephydatia_fluviatilis_EfAGO ---------------------------FDGRKNLYSR-KPL-PVSIK-LV-A-QVNLPFDAIQALD-VVMRHLPSGRSFFTLGNGRFGFHQSIRPSQKMMLNIVS-ATAFYKQPVLNFLCEKEIKGLKVEVTHRKYRVCNVTRRPASASVVHYFLPCLQVGQ-EKK-HYLPLEVCNLVPGQRCIKKSKMIRATSRTAPDRLM-LQA-DFDPFV-QDFGISVDENMVTVEGRVLPPPGVWD--MRGKQVYVWAIVVFCVQLRKVEPVFRQLQ-LVMIILPG--KVKRVGDTQLGVATQCV-QTLSNLCLKINVKLGGINSILHYPVIFMGADVTHPAGD-DPSIAALVAPSRYSATVRVQQRQEI--IAELEMLIQFKPQRIIFY-RDGVSEGQFQQVLHHELVSIRQACPGITFVVVQKRHHTRLFS-GNIPATTVDTGITHPTEFDFFLCSHAGVGTSRPSHYHVLWDDFTADELQCLTYQLCHTYVRCTRSVSYPAPAYYAHLVAFRARYHLQAVR-VH Eucalyptus_grandis_EgAGO1 GTRC-IVKANHFFAELLHQYDVMKKLAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPTGRSFYSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVTQKALRGVKVEVTHRKYRISGLTSQATRESVVEYFWPCLQVGN-QNR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPHERTV-RHN-AYDPYA-KEFGIKISERLAQVEARILPAPGCWN--MMNKKVNNWFCINFSHELAHVERILKARD-LLIVILPD--NLKRICETDLGLVSQCC-QYLANVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAVTKYAGLVCAQARQEL--IQDLELLISFKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Eucalyptus_grandis_EgAGO10a GTRC-IVKANHFFAVLLNQYDIMAELAYDGRKSLYTA-GEL-PVVIK-FV-A-RANMPQEALQVLD-IVLRELSTGRSFFSLGDGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIEFVAQKALRGVKVEVTHRKYRVSGLTSQPTRESVVEYFLPCLQVGN-QKK-AYLPMEACKIVEGQRYTKRTALLKVTCQRPRDRTV-QQN-AYDPYA-KEFGIKISEKLASVEARILPAPGQWN--MMNKKVNRWACINFSSELAQVEKALKHVE-LLLAILPD--NLKRICETDLGIISQCC-QYLANVSLKINVKMGGRNTVLDIPTIIFGADVTHPNGE-DPSIAAVVAVTKYAGLVCAQARQEL--IQDLDLLVSFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFIVVQKRHHTRLFS-GNIMPTVVDTKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRARFYMELPA-LK Eucalyptus_grandis_EgAGO10b GEKC-IIKANHFFAQLFHHYDIMKKLVYDGRKSLYTA-GPL-PVIIK-LA-A-RADLPQEVLQVLD-IVLRESPSGRSFFSLGEGLRGFYQSIRPTQGLSLNIMS-TTAFIELPVVEFVTKKALRGVKIEVTHRKYRISNLTSQTTRESVIRYFWPCLQVGN-PTK-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPKERTV-DCN-RYDRYA-EEFGIKISRSLARVEARVLPAPGCWN--MMHKRVNHWLCISFSSELVESEKVLRSRD-LLIVILPD--NIKRICETDLGLVSQCC-QYLANVALKINVKVGGRNTVLDQPTIVFGADVTHPPGE-DPSIAAVVAITKYAGLVCAQAREEL--IQDLELLVSFKPQRIIFY-RDGVSEGQFYQVLLHELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSQICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFSADGLQSLTNKLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMDLPA-IK Eucalyptus_grandis_EgAGO4a GQKI-PLLTNHFKVNVFFHYSVIDKVAYDGEKSLFTV-GPL-PVEIS-FA-A-KIPMSQEALRVLD-IVLRQHASRQSFFHVGGGVRGFHSSFRTSQGLSLNIVS-TTMIIQGPVVDFLIARTLKNLRIKASPMEYKITGLSERPCKETVYDYFFPCINVGK-PKR-PFIPLELCTLVSLQRYTKAASLVEKSRQKPQERAL-NLN-RYEPML-RSCGVSINTKFTQVEGRVLPAPGRWN--FNNKKIERWAVVNFSRDLIKVEKMFEEIQ-FLLCLLPE-RKWKKKNLAEFGIVTQCI-QYLTNVLLKINAKLGGLNSVLKLPTIILGMDVSHGPGQ-SPSIAAVVSISRYRASVRTQSKVEM--IDNLELLLDFKPEQIIIF-RDGVSESQFNQVLNIELDQIIEACPKFVVIVAQKNHHTKFFP-DNVPPTIIDNKVCHPRNNDFYLCAHAGMGTTRPTHYHVLMDEFSADDLQELVHSLSYVYQRSTTAISVVAPVCYAHLAATQMGQFMKLPR-LQ Eucalyptus_grandis_EgAGO4b GQKI-ALLTNHFKVNVFFHYSVMDRVAYDGEKSLFTI-GPL-PVEIS-FA-A-KIPMFQEAVRVLD-IILRQHAARQSFFHVGGGVRGFHSSFRTTQGLSLNIVS-TTMIIQGPVIDFLIARTLKNLRIKASPAEYKITGLSESPCKDTVYDYFFPCINVGK-PKR-PYIPLELCSLVSLQRYTKSASLVEKSRQKPQERAL-KRS-NYEPML-RSCGITISNSFTQVEGRVLPAPGRWS--FQNKKMQKWAVVNFSRDLTRVDKMFEEIL-FLLCLIPE-RKWKKKNLSDYGIITQCL-QYLTNVLLKINAKLGGLNSLLKVPTMILGMDVSHGPGH-SPSIAAVVSISRYRATVRTQSKVEM--IDSLELLLDFKPDQIIIF-RDGVSESQFMQVLNIELDQIIEACPKFVVIVAQKNHHTKFFPENNVPPTVIDNKVCHPRNNDFYLCAHAGMGTTRPTHYHVLYDEYSADELQELVHALSYVYQRSTTAISVVAPICYAHLAATQLAHFVKMPK-LQ Eucalyptus_grandis_EgAGO4c GQKI-ALLTNHFKVNVFFHYSVMDRVAYDGEKSLFTI-GPL-PVEIS-FA-A-KIPMFQEAVRVLD-IILRQHAARQSFFHVGGGVRGFHSSFRTTQGLSLNIVS-TTMIIQGPVIDFLIARTLKNLRIKASPAEYKITGLSESPCKDTVYDYFFPCINVGK-PKR-PYIPLELCSLVSLQRYTKSASLVEKSRQKPQERAL-KRS-NYEPML-RSCGITISNSFTQVEGRVLPAPGRWS--FQNKKMQKWAVVNFSRDLTRVDKMFEEIL-FLLCLIPE-RKWKKKNLSDYGIITQCL-QYLTNVLLKINAKLGGLNSLLKVPTMILGMDVSHGPGH-SPSIAAVVSISRYRATVRTQSKVEM--IDSLELLLDFKPDQIIIF-RDGVSESQFMQVLNIELDQIIEACPKFVVIVAQKNHHTKFFPENNVPPTVIDNKVCHPRNNDFYLCAHAGMGTTRPTHYHVLYDEYSADELQELVHALSYVYQRSTTAISVVAPICYAHLAATQLAHFVKMPK-LQ Eucalyptus_grandis_EgAGO7 GPVI-SLLANHFLVQVIYHYNIKRQLAFDGRKNLFSP-VEF-QINMK-LV-S-KLDGPQDYLHALD-VVLRESPAGRSMYSIGGGARGFFQSLRPTQGLSLNVFS-VTAFHEIGVIPYLERKALKNIRIFVCHQRYRVYGLTEAPTENKLVSYFLPCLQTSR--SK-PYLPMELCVICEGQKFLGKARILKMGCQRPKERVM-RGPVGPGNQE-REFNLQISREMTRVNGRILQPPRQWN--LMDSHIEKWALISFGSQLSQLESKLKEIR-LLLCIMEK--KLKRIAETTIGVVSQCC-QFLANLALKINAKVGGCTVALNEPVIFMGADVTHPPLD-DPSVAAVVGANKYASRMRSQTRQEI--IQDLELLDDFLPRRIIFF-RDGVSETQFHKVLKEELLAIKKGCPTVTFVVVQKRHHTRLFD-ENIPPTVVDTVITHPKEFDFYLCSHSGVGTSRPAHYHVLVDEFTSDELQKLVYNLCYTFVRCTKPVSLVPPAYYAHLAAYRGRLYLELPK-LS Glycine_max_GmAGO10like GTKC-IVKANHFFAELLNQYDIIAELAYDGRKSLYTA-GQL-PVVIK-FV-A-RANLPQEALQILD-IVLRELSTGRSFFSLGEGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVVEFVGQKALRGVKVEVTHRKYRVSGLTSQPTRESVVEYFLPCLQVGN-QKK-AYLPMEACKIVEGQRYTKRTALLKVTCQRPRDRTV-QHN-AYDPYA-KEFGIKISEKLASVEARILPAPGQWN--MMNKKVSRWACINFSNELAQVEKALKHVE-LLLAILPD--NLKRICETDLGLISQCC-QYLANVSLKINVKMGGRNTVLDMPTIIFGADVTHPNGE-EPSIAAVVAVTKYAGLVCAQARQEL--IQDLDLLVSFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFIVVQKRHHTRLFS-GNILPTVVDTKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTPDGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRARFYMELPD-LK Glycine_max_GmAGO16like GKHI-PLLVNLFEVAVFFQYSVIDRLVYDGGKTLYTV-GPL-PVEIS-FA-T-KIPLSQDALRVLD-TILRQRAARQSFFHVGAGVSGFHSSFRSTQGLSLNIVS-TTIIIKGPVIDFLLSKMLKNLRVQATHQEFKISGLSEKPCIQTVYEYFLPCLDVGK-PKR-PYLPLELCSLVSLQRYTKVASLVEKSRQKPQDRAV-GKC--YDPVL-AACGISIEKQLNLIEGRVLETPGRWN--FNKKTIDYWAVVNFSRELIRVERMFDLLK-LILCVLPE-RKWKKKCLSEIGVVTQCI-QYLTNVLLKINSKLGGINSLLDTPTMILGMDVSHNLGR-LPSIAAVVGISRYRASVRMQAKVEM--IDALELLLDFKPTQFIVF-RDGVSESQFEQVLTIELNQIIKAYPQFTVIVAQKKHHIKLFP-ENVPPTVVDTTITHPRNYDFYMCAHAGMGTSRPVHYHVLLDEFSADGLQNLIHSLSYVNQRSTIATSVVAPICYAHHAAAQMGQLLNLPR-LH Glycine_max_GmAGO2like1 ILTS-RLRVNHFPVKFIMHYSIREKLAHDGAKNIYSA-VQL-PVTLT-LV-N-KLRLPRDILQGMD-VVVKENPAGRHFYPLHHGIGGFQHSLKPTSGLSLCVYS-VLAFRKMSVLDFLHEEALIGLKVNVTHRKYIISRLTPMITRYSLITFFIPCLDLGK-DRK-KYVPMEFCVLVEGQRYPKENTLKAMSLAHPNERMV-QSSDGPSDLI-QNFGISVNTTMTTIVGRVLGPPCHWN--LAGKSVEYWGVLDFTQKLIGLSELLEKIQ-FLLCVMAK--KLKWISETKLGILTQCC-KFYTNLALKINAKLGGSNVELEGDVMFLGADVNHPYQD-TPSIAAVVAANRYAARVFPQYRSEK--ILNFELVACYRPERIVIF-RDGVSEYQFDMVLNEELLDLKGVFPTITLIVTQKRHHTRFFS-GNVLPTVVDTKVIHPYEFDFYLCSYYGNGTSKPTHYHVLWDEFTSDLLQKLIYEMCFTFAKCTKPVSLVPPVYYADLAAYRGRLYHEFYT-LH Glycine_max_GmAGO2like2 VRKC-YLRVNHFPVSFIMHYNIRDKLAYDGEKNIFSA-VPL-PVSLT-LV-S-RLELPRDVLHGLD-LVVKENPSGRCFFPLNHGIGGFQQSLKSTSGLSLCLYS-VLSFRKLLVLDFLHEHVLIGLKVNVKHQKYTITRLTPKVTRHTLVGYFIPALDFG--GNK-TFVPMELCELVEGQRYPKEKDLKDMSVAPPRVRMV-NSEDGPGGVI-KNFGMSVNTSMTNVTGRVIQPPCQWN--LVGRSVECWGILDFTENLMGLCKLLENIQ-FLLCVMSD--KLKWIAETKVGIVTQCC-QYLTNLALKINAKIGGSNVELEGHVMFIGADVNHPSRD-IPSIAAVVAANRYAARVCAQGRVEK--ILNFELVSYYRPEKIVVF-RDGVSESQFHMVLTEELQDLKSVFPTITIIVAQKRHQTRFFN-GNVFPTVVDTKVVHPFEFDFYLCSHYGSGTSKPTHYHVLWDEFNSDDLQKLIYDMCFTFARCTKPVSLVPPVYYADLTAYRGRLYYEYYK-LH Glycine_max_GmAGO4Blike GEPR-QLLANHFGVCLFYHYDVLNQVAYDGEKSLFTL-GPL-AVDIK-YA-A-KIPLSQEAVRVLD-IILRQHSARQSFFHIGGGVRGFHSSFRVTQGLSLNMVT-TTMIVKGPVVDFLLQRMLKNLRIRA--VEFKISGLSDNTCRNTVHDYFMPCINVGK-PKR-PYFPIELCEMVSLQRYTKAAQLVEKTRQKPQVRAL-RSS-RYEPML-RSSGITIEPNFVRLVGRVLEPPGRWN--FNNKKIGRWAIVNFSELIRRVERMYAKLH-FLLCILPE-KKWKKKSLVEEGIVTQCI-QYITNVLLKINAKYGGMNSYLAVPTLILGMDVSHGPGR-SPSIAAVVSISRYRASVRTQSKVEM--IQSLEVLLDFKPQQIIIF-RDGVSESQFNQVLNIELSQIIEACPKFTLIIAQKNHHTRFFQ-TNVPPTVIDNTVCHPKNNDFYLCAQAGMGTTRPTHYHVLHDEFSADEVQELVHSLSYTYQRSTTAVSLVAPICYAHLAAAQMAQFMKLPR-LH Glycine_max_GmAGO4like GTKL-QLLTNHYRVNVFYQYSLLDRVAYDGEKTLFTL-GSL-AVELS-YA-S-KIPLYQEAIRVLD-IILRQHAARQSFFHVGGGVRGFHSSFRTTQGLSLNIVS-TTMIITGPVVDFLISRTLKNLRIKASPQEFKITGISEFPCKDTVYDYFLPCINVGK-PKR-PYIPLELCSLVSLQRYTKAASLVEKSRQKPQERAL-KSS-NYEPML-RNCGISISPNFTEVEGRVLQAPGRWN--FNNKKIERWAVVNFSRDLIKVEKMFELVQ-FLLCLLPE-RKWKKKNLAEFGIVTQCI-QYLTNVLLKINAKLGGLNSILRAPTIIIGMDVSHGPGQ-TPSIAAVVSISKYRASVRTQSKMEM--IDNLELLLDFKPDNIIIF-RDGVSESQFNQVLNIELDQIIEACPKFLVIVAQKNHHTKFFP-DNVPPTVIDNKICHPRNYDFYMCAHAGMGTSRPTHYHVLLDEFSPDDLQELVHSLSYVYQRSTTAISVVAPICYAHLAATQMGQFMKLPR-LQ Glycine_max_GmAGO5like2 GEKI-KVRANHFQVQVLFHYDVMTLLAYDGGKSLFTA-GSL-PVTIR-LA-S-RTDIPYETIQALD-VVLRATPSGRSFFSLGSGTRGYYQSLRPTQGLSLNIVS-ARAFYEIPVIDFIESRVLRGVKVEVTHRRYKITGVTKEQLRKSVVQYFLPALQAGS-DIK-PFLPMELCQIVAGQRYTKRTNLLRASCQRPRDRVV-RQS-NFDKFV-SHFGIQVREDPALLDARVLPAPGQWN--MIDKKVEHWTCLNFSHKLARIESALVNLQ-LLIIILPD--FIKRICETELGIVSQCC-QYLENVALKINVKVGGSNTVLDRPTLILGADVTHPPGE-DPSIAAVVAVTRYRGVVSAQTREEI--IQDLELLRAFKPERIIFY-RDGVSEGQFSQVLLYEMDAIRRACPRVTFVVVQKRHHTRLFS-GNIMPTVVDTHICHPREFDFYLNSHAGMGTSRPTHYHVLFDEFTADGLQMFTNNLCYTYARCTRSVSIVPPVYYAHLAAFRARCYIELPS-VK Glycine_max_GmAGO7like GSVI-SLLANHFLVQFIYHYNIKQKLAYDGRKNLYSP-VEF-QINVK-LV-S-KINGPQDYLHALD-VVLRESPTGRSFYSIGGGARGFFQSLRPTQGLALNVFS-VTAFHEIGVIAYLQKKALKSIRVFVCHQRYRVYGLTEEVTENRLVNYFLPCLQISR--SK-PYLPMELCVICEGQKFLGKARILKMGCQRPAERVM-RGTVGPGDQE-KEFKLQVSREMTKLTGRILHPPRQWN--LLDGHIERWALISFGNQLCQLESKLKRIQ-LLICIMER--KLKRIAETSVGVMSQCC-QFLANLVLKINAKVGGCTVALDEPVIFMGADVTHPPLD-DPSVAAVVGANKYISRIRSQTRQEI--IQDLELLDDFLPNRIIFF-RDGVSETQFYKVLEEELQSIRFACPTITFAVVQKRHHTRLFY-ENIPPTVVDSVITHPKEFDFYLCSHWGVGTSRPTHYHVLWDEFTSDELQKLVYNLCYTFVRCTKPISLVPPAYYAHLAAYRGRLYLELPK-LS Glycine_max_GmAGOlike1 GTKC-VVKANHFFAELLHQYDVMEQLAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPTGRSFYSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVNQKALRGIKVEVTHRKYRISGLTSQATRESVVEYFWPCLQVGN-TQR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPVERTV-HHN-AYDPYA-KEFGIKISEKLAQVEARILPAPGQWN--MMNKKVNNWFCINFSYELAQVEKVLKTRD-LLIVILPD--NLKRICETDLGLVSQCC-QYLANVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAITKYAGLVCAQARQEL--IQDLELLISFKPQRIIFY-RDGVSEGQFYQVLLFELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADALQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Glycine_max_GmAGOlike2 GNKI-QLLTNHFKVNVFFHYSIIDRVAYDGEKSLFTV-GSL-PVEIS-FA-A-KIPMFQEAIRVLD-IILRQHAARQSFFHVGGGVRGFHSSFRTTQGLSLNIVS-TTMIISGPVVDFLISRTLKNLRIKTSPQEFKISGLSELPCRETVYDYFLPCINVGK-PKR-PFFPIEVCELVSLQRYTKAASLVEKSRQKPQERAL-RTS-NYEPML-RNCGISISTGFTEVEGRVLPAPGRWN--VSRVKIERWAVANFSRDLIRVEKMFEHIQ-FLLCLLPD-RKWKKKNLADFGIINQCM-QYLTNVMLKINAKLGGLNSLLKAPTLILGMDVSHGPGQ-TPSIAAVVSISKYRACVRTQSKMEM--IDNLELLLDFKPENIIIF-RDGVSESQFNQVLNIELDRIIEACPKFVVIVAQKNHHTRFFP-DNVPPTVIDNKICHPRNYDFYLCAHAGMGTSRPTHYHVLLDQFSPDQLQELVHSLSYVYQRSTTAISVVAPICYAHLAATQLGQFMKLPP-LQ Glycine_max_GmPNH1like1 GTKC-VIKANHFLADILSHYNIIAELVYDGGRNLYTA-GLL-PVVIK-FA-T-RVSMPQEALSVFD-IVLRELAAGRFLYSLGGGLRGFYQSIRPTQGLSLNIMS-SMAFIELPVIDFVAQKALRGVKVEVTHRKYRISGLTSQPTRESVVDYFLPCLQVGS-QRK-VYLPMEACKIVGGQRYTKGTSLLKISCQRPREQTI-QQN-NYNPYA-KEFGISIENKLASVEARVLPAPGQWN--MMNKKVRYWACINFSQQLVQVKKALKYVE-LLIAILPD--NLKRICETDLGLISQCC-QYLANVALKINVKMGGRNTVLDIPTIIFGADVTHPSGE-DPSIAAVVAVTKYAGLVCAQPREEL--IQDLELLLSFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPSEFDFYLCSHAGIGTSRPAHYHVLWDEFTADEIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAYRARFYMELPA-LK Glycine_max_GmPNH1like2 GTKC-LVKANHFLADILSHYNIIAELVYDGGRNLYTA-GLL-SVVIR-FA-A-RVSMPQEALTVID-TVLRELAAGRFLYSLGGGLCGFYQSIRPTQGLSLNIMS-SMAFIELPVIDFVAQKALRGVKVEVTHRKYRITGLTSQPTRESVVDYFLPCLQVGS-QKK-VYLPMEACKIVGGQRYTKGTSLLKVSCQRPREQTI-HQN-DYNPYA-KEFGISIDSKLASVEARVLPAPGQWN--MMNKKVRYWACINFSQQLVQVKKALKYVE-LLIAILPD--NLKRICETDLGLISQCC-QYLANVALKINVKMGGRNTVLDIPTIIFGADVTHPSGE-DPSIAAVVAVTKYAGLVCAQPREEL--IQDLELLLSFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADEIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAYRARFYMELPA-LK Homo_sapiens_HsAGO2 GRTI-KLQANFFEMDIIYHYEIVEHMVFDGRKNLYTA-MPL-PVSIK-WV-S-CVSLPFETIQALD-VVMRHLPSGRSFFTLGGGRFGFHQSVRPSLKMMLNIVS-ATAFYKQPVIEFVCEKEIKGLKVEITHRKYRVCNVTRRPASHTVAQYFLPCLQVGQ-EQK-HYLPLEVCNIVAGQRCIKKSTMIRATARSAPDRLM-RSA-DFDPYV-REFGIMVKDEMTDVTGRVLQPPGVWD--MRNKQIKVWAIACFAEQLRKVEPMFRHLQ-LVVVILPG--KVKRVGDTVLGMATQCV-QTLSNLCLKINVKLGGVNNILQQPVIFLGADVTHPAGD-GPSIAAVVGPNRYCATVRVQQRQEI--IQDLELLIQFKPTRIIFY-RDGVSEGQFQQVLHHELLAIREACPGITFIVVQKRHHTRLFS-GNIPATTVDTKITHPTEFDFYLCSHAGIGTSRPSHYHVLWDDFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVAVQ-VH Hordeum_vulgare_HvAGO10 GDRC-VVKANHFFAELLHQYDVIAELAYDGRKSLYTA-GPL-PVVIK-YA-A-RADLPQEALQVLD-IVLRELPTSRSFYSLGDGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIEFVAQKALRGVKVEVTHRKYRISGLTSQATRETVVQYFLPCLQVGN-QQR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPQERTV-HHN-AYDPYA-QEFGIKIDEQLASVEARVLPPPGQWN--MMNKKVSHWACINFSHELAIVERALKARD-LLIVILPD--NLKRICETELGLVSQCC-QYLANVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAITKYAGLVSAQARQEL--IQDLELLISFKPQRIIFY-RDGVSEGQFYQVLLFELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADELQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Hordeum_vulgare_HvAGO1a --------------------------AYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTGRSFYSLGDGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVAQKALRGVKVEVTHRKYRISGLTSQATRETVVQYFLPCLQVGN-QQR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPQERTV-HHN-AYDPYA-QEFGIKIDERLASVEARVLPPPGQWN--MMNKKVSHWACINFSHELAIVERALKARD-LLIVILPD--NLKRICETDLGLVSQCC-QYLANVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAVTKYAGLVSAQARQEL--IQDLELLISFKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADELQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Hordeum_vulgare_HvAGO1b --------------------QVINELAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPSGRSFFSLGDGLRGFYQSIRPTQGLSLNIMS-ATAFIELPVIDYAAQKALRGVKVEVTHRKYRISGLTTQATRESVVQYFLPCLQVGN-QQR-PYLPMEVCKIVEGQRYSKRRALLDETCQYPRDRMV-KHN-AYDPYA-KEFGIKISDRLASVDARILPAPGQWN--MMNKKVRSWMCVNFAHQLAQVERALKARD-LLIGILPD--NLKRVCEIDLGIVSQCC-QIYANIALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAVTRYAGLVSAQARQEL--IEDLELLISFKPQRIIFY-RDGVSEGQFYQVLLFELNAIRKACPKVTFVVVQKRHHTRLFS-GNILPTVVDTKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGLQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-MK Hordeum_vulgare_HvAGO3 QARV-QLLVNHFIVKYFFHYDAKAELAYDGKRNLFTA-AQL-PVSVE-FK-K-QLPLAREILQGLD-VIVREASTGHGFYSMGSGVKGTQQTLKHTQGLVLCVYS-VMPFRKGPVLDIVRQYELKGQRITVSHQKYTIQGFTDLPASQRLVDYFLPCLDLSKSRDK-PYVPIELCKLVEGQRYPMARALKGKALIKAAERAV-KAEDGPGEIA-QQFGISLDVKMMEVTGRVLTPPCQWN--LMGKKLQCWGIVDFSNYIVRLHEELNKAQ-LLFCPMSE--QLKLICETQLGIQTQCF-QYMSNLALKINGKLGGINTQLGVPYMFIGADVNHPPGN-GPSIAAVVAATKYVPRIRAQPRCEV--IKNLELIGVFKPQRIIYF-RDGVSDGQFEMVLNEELADMENVIPTITVIVAKKRHHTRLFN-GNVLPTVVDTRIVDPVTYDFYLCSHNGLGTSRPTHYYNLMDEYGSDDLQRLVYNLCFVFARCTKPVSLATPVYYADLAAYRGRLYYEFPT-LH Hordeum_vulgare_HvAGO5 GKKV-MIRANHFLVNVLFHYDVLSELAYDGRKSLYTA-GSL-PITIR-IA-G-RTDLPQETIQVLD-VVLRESPSSRSFFSIGEGLRGYYQSLRPTQGLSLNIIS-ATSFFKVTVVQFVLEKALRGVRVETNHRRYKITGITPIPMSQSVVQYFWPCLQSGS-DAR-PYLPMEACKIVEGQRYSKKTNILRATCQRPQQRMV-LHN-KYDKFA-QEFGIKVCSDLVAVPARVLPPPGQWN--MINKKIDNWACVSFSCDLIQIENALRDVQ-LLIVILPE--VIKKVCETDLGIVSQCC-QYLENVALKINVKVGGRNTVLEVPTIIFGADVTHPPGE-DSSIAAVVAITKYRGLVSAQPRQEI--IEDLELLIAFRPERILFY-RDGVSEGQFSHVLLHEMDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDLMICHPTEFDFYLCSHAGIGTSRPTHYHVLYDEFTADALQSLTNNLCYTYARCTRAVSVVPPAYYAHLAAFRARYYVELPK-IK Hydra_vulgaris_HyvAGO2like ------------------------------------------------------------------------------------------MSVRPSQKMLMNIVC-ATAFYRMDVVEYLYEREIKGLKIEITYRKYKVNGVTEKSVTESVAEYFLPCLHVGD-EKK-TYIPMEVCKVVPGQRCLKRAEMIQIAAKRPNKRIM-KNA-NFDKYL-NSFGIQIANSMVELNGRILPTPGK---HFYNKKLKKKACPTAQ-----PESVISKAE-LLVFILPG--KIKRLCETNKGVCTQCI-MTLAQLCLKINSKMGGTNNVIKEPVIFLGADVTHPLGD-KPSIAAIVGPSRYSACVRIQGRVEV--IEDLELLKQFKPRKIIMF-RDGVSEGQFQQVLFHEMSAIQKACPGITFVVVQKRHKAKFFS-GNVSATTIDTVVCHPTEFDYYQYSHSGIGTSRPAHYHVLWDDFSADELQALSFMLCHLYVRCTRSVSIPAPAYYAHHVAFRSRSHLQVVK-LH Isodiametrica_pulchra_IpPIWIlike2 GRHI-SLHTNHLVLEKFTMYHFRHRLSFDGSV-LFTP-NPL-PISLK-HV-R-DLGPTRIYGTVFQ-KIMRLLKFGKSFDTSQHNVPGYITSVSPSDGLRLLCVS-HKVIRTESVLQFMATEEIVGTSVLTPYKTYKIDDIDWQTSPENLVQYYQPLLVHID-KKRRNYLVPELCQLTGLSDKMREKDVGAHTRVAPRDRFISRVNSSPSEEL-RAWGLKLANQPLELPARNILNACDFSNQLTANKLTRWLVIYSGPDLLHAEDYIRAIQ-IVVCLLPT--KIKRQCCISTPVASQVI-RIVQNIGLQMVAKMGGELWGVVGRLMVVGIDVYHEKKR--ESWLGVCCATRYKSSVHKQTGVEL---GGFKSLYKYLPERILIY-RDGVGDGQMRLVRETEIPQLISACPAFTVVICQKRINQRFFK-GNPMPTIVDTDVTRRGFQDFYLVSQHVRGTVTPTHYVVLRNDLDVDCIQKCTFRLTYMYYNWPGSVRVPAPCQYAHKLAQLAGLNISTPS--- Kluyveromyces_polysporus_YeastAGO GTKV-DILTNHILLAVIFTYHLIEALAFNGEDTIYSH-VPL--ITLK-FS-G-KVGLQESRMSAIDKTCLLSLLGGNKFFIFQIGGQGFTVSLTHVYGVALNTVSVPAPFIKFTLMDWIIEALLKGLKVYRPYSSKGIVGFTRESAVSNTIDYFMKLVNLGG---K-NVVPPECLTIVPGQKLKGQKTYIDFSAIRPTEKAI-KRG-LTEKEE-SSAPHNSAYQFMRVPSRILDAPGNWN--MKGHQVNLRAIFINNDKFASLLNLLENIT-YILYVLRR-GNLKYITDLKFGALNSCV-QYNSNVVMKMNLKLLGSNHSLNLPILVLGSDVTHYEKD--NSIASLVGFTQFPGDYMLQDGEEI--ITNVNRLKIYLPTKIMYF-RDGVSVDQFSQVVKIEVKSIKESVPPVTCIATVKRNQVRFIM-GNVMPTVVDRGITSVAHFDFFIQSHQALGTGVPCHYWCLYDESTSDYLQEICNNLCYIFGRSTTSVKVPAPVYYADLLCTRATCFFKLPQ-VN Linum_usitatissimum_LuAGO1 GHKC-VVKANHFFAELLHQYDVINQLAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPNGRSFYSLGDGLRGFYQSIRPTQGLSLNIMS-STAFIELHVIDFVCQRALRGVKVEVTHRKYRISGLTSQATRDSVVEYFWPCLQVGN-QQR-PYLPMEVCKIVEGQRYSKKTNLLKVTCQRPVDRTV-RHN-AYDPYA-TEFGIKISKNLASVEARILPAPGQWN--MMNKKVNNWICLNFSFELAQVEKVLKTHD-LLIVILPD--DLKRICETDLGLVSQCC-QYLANVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAITKYAGLVCAQARQEL--IQDLELLISFKPERIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFSADALQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPS-LK Linum_usitatissimum_LuAGO10a GTKC-VVKANHFFSELLNQYDIMAELAYDGRKSLYTA-GEL-PVALK-FV-A-RANMPQEALKILD-IVLRELSTGRSFFSLGEGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVVEYVAQKAFRGVKVEVTHRKYRVSGLTAQPTRESVVEYFLPCLTVGN-QKK-AYLPMEACKIVEGQRYSKRTALLKVTCQRPRDRTV-QQN-AYDPYA-KEFGLNISEKLASVEARILPAPGQWN--MMNKKVNRWACINFSSELGQVEKALKHVE-LLLAILPD--NLKRICETDLGIISQCC-QYLANVSLKINVKMGGRNTVLDIPTIIFGADVTHPNGE-DPSIAAVVAVTKYAGLVCAQARQEL--IQDLDLLISFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPLVTFIVVQKRHHTRLFS-GNVLPTVVDTKICHPSEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRARFYLELPA-LK Linum_usitatissimum_LuAGO10b GLRC-VVKANHFFAELLHQYDVINQLAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPNGRSFYSLGDGLRGFYQSIRPTQGLSLNIMS-STAFIELKVIDFVTQKALRGVKVEVTHRKYRISGLTSQATRESVVEYFWPCLQVGN-QQR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPQERTV-QHN-AYDPYA-KEFGIKISERLASVEARILPAPGQWN--MMNKKVNYWLCINFSYELAQVERVLKARD-LLVVILPD--NLKRICETDLGLVSQCC-QYLANVSLKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAITKYAGLVCAQARQEL--IQDLELLISFKPERIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFSADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPS-LK Linum_usitatissimum_LuAGO4a GQKI-TLLTNHFKVNVFYHYS----------------------VQLN-FA-A-KIPMSQEALRVLD-IILRQHAARQSFFHLGGGVRGFHSSFRTTQGLSLNIVS-TTMIIQGPVVDFLISRVLKNLRIKVSPQEYKITGLSDQPCKETVYDYFLPCINVGK-PKR-PYIPLELCSLVSLQRYTKASSLVEKSRQKPQERSL-KTS-KYEPML-RSCGISIGTSFLQVEGRVLPAPGRWN--FNNKRVERWAVVNFSPDLLRVEKMFEAIK-FLLCILPE-RKWKRKCLSDFGIFTQCL-QYLTNLLLKINAKLGGLNSLLKVPTMILGMDVSHGPGQ-FPSIAAVVSISKYRASVRTQSKVEM--IDSLEALLDFKPEQIIIF-RDGVSESQFNQVLNIELDQIIEACPKFVVIVAQKNHHTKFFP-DNVPPTIIDNKVGHPKNNDFYLCAHAGMGTTRPTHYHVLMDEFSTDDLQELVHSLSYVYQRSTTAISVVAPICYAHLAASQMGQFIKLPR-LE Linum_usitatissimum_LuAGO4b GQKI-TLMTNHFKVNVFYHYSVLDKVAYDGEKSLFTI-GQL-PVQLN-FA-A-KIPMSQEALRVLD-IILRQHAARQSFFHLGGGVRGFHSSFRTTQGLSLNIVS-TTMIIQGPVVDFLISRVLKNLRIKVSPQEYKITGLSDQLCKETVYDYFLPCINVGK-PKR-PYIPLELCSLVSLQRYTKASSLVEKSRQKPQER----------------------------------------------RVERWAVVNFSPDLLRVEKMFEAIK-FLLCILPE-RKWKRKCLSDFGIFTQCL-QYLTNLLLKINAKLGGLNSLLKVPTMILGMDVSHGPGQ-FPSIAAAISISKYRASVRTQSKVEM--IDSLEALLDFKPEQIIIF-RDGVSESQFNQVLNIELDQIIEACPKFVVIVAQKNHHTKFFP-DNVPPTIIDNKVGHPKNNDFYLCAHAGMGTTRPTHYHVLMDEFSSDDLQELVHSLSYVYQRSTTAISVVAPICYAHLAASQMGQFIKLPK-LE Linum_usitatissimum_LuAGO5 GHKC-VVKANHFFAELLHQYDVINQLAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPNGRSFYSLGDGLRGFYQSIRPTQGLSLNIMS-STAFIELHVIDFVCQRALRGVKVEVTHRKYRISGLTSQATRDSVVEYFWPCLQVGN-QQR-PYLPMEVCKIVEGQRYSKRTNLLKVTCQRPVDRTV-KHN-AYDPYA-TEFGIKISKNLASVEARILPAPGQWN--MMNKKVNNWICINFSFELAQVEKVLKTHD-LLIVILPD--KLKRICETDLGLVSQCC-QYLANVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAITKYAGLVCAQARQEL--IQDLELLISFKPERIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFSADALQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPS-LK Linum_usitatissimum_LuAGO6 GQRI-TLLTNHFKVSVFYQYTLIDKLAYDGEKTLYTV-GPL-PIEIS-YA-A-KIPLIQDALRVLD-IILRQQAARQSFFHVGQGVRGFHSSFRTTHGLSLNMVS-TTMVLTGPVIDFLLVRMLKNLRIKTTHREFKIIGLSERPCRQTVYDYYFPCLNVGK-PKK-PYLPIELCSLTSLQRYTKAASLVEKSRQKPQDRAM-RKY-RYDPLL-LECGISLEKNLTPVTGRVLKTPGRWN--FNNKTIERWAIVNFSRDLIAVESMFELVQ-FLLCLLPQ-RKWKKKCLSDFGIVTQCI-QYLTNVLLKINSKFGGINSMLQTPTMILGMDVSHGPGG-SPSVAAVVGVTKYRASVRTQSKVEM--IDALELFREFKPKQIIIF-RDGVSESQFNQVLNIELPQIIKAYPKFTVIIAQKNHHTKLFN-DNVPPTVVDTTVVHPRNYDFYMCAHNGAGTSRPAHYHVLIDEFTPDELQNLIHSLSYVYQRSTTAISIVAPVCYAHLAAAQMSQFIKLPK-LH Linum_usitatissimum_LuAGO7 GSMI-TLLANHFLVKFIYHYNIKQKMSYDGRKNLYSP-VQF-QVNIN-LV-S-KLKGPQDYLHALD-VVLRESPSGRSMYSIGGGARGFFQSLRPTQGLALNVFS-VTAFHEIGVIFYLQKKALKNIRVFVSHQRYKVYGLTDEATENRVVDYFLPCLQISR--SK-PYLPMELCMICDGQKFIGKAKILNMGCQRPKERVM-QGPVGPGNQA-KEFKLHVSREMTRLKGRILQPPRQWN--LLDGHIERWGLISFGRQLSHLETKLKNIQ-LLICLMEK--KLKRIAETSAGVVTQCC-QFLANIALKINAKVGGCTVALDEPVIFMGADVTHPPFD-DPSVAAVVGANKYVSRMRSQTRQEI--IHDLELLDEFLPRRIMFF-RDGVSETQFKKVLKEELQAIKEACPLITFAVVQKRHHTKLFD-ENIPPTVVDTVITHPTEFDFYLCSHWGVGTSRPTHYHVLWDEFTSDELQKLVYNLCYTFVRCTKPVSLVPPVYYAHLAAYRGRLYVDLPK-LS Linum_usitatissimum_LuAGO9 GRPI-PLLTNHYRVSVFYQYSLIDKLAYDGEKALYTV-GPL-PVEVN-YA-A-MIPMVQDAVRVLD-IILRQQAARQSFFHIGQGVRGFHSSFRTTHGLSLNMVS-TTMVVSGPVIDFLLTRMLKNLRIKATHREFKIIGLSPQRCNQTVYEYFFPCLDVGK-PKR-PYLPVELCSLVSLQRYTKAASLVEKSRQKPQDRAM-AKY-RYDPLL-AECGISIQKDLTPVNGRVLDTPGRWN--FNNKTIDKWGIVNFSRELNNVEGMFKQVG-FILCVLPQ-KKWKKKCLSDFGIVTQCI-QYLTNVLLKINAKLGGVNSMLKVPTMILGIDVSHGPGR-SPSIAAVVGITRYSGAVRTQSKVEM--IDGLKLFVSFKPRQIVIF-RDGVSESQFNQVLNIELPQIIKAYPKFTVIIAQKNHHTKLFP-DNVPATIVDTTIVHPRNYDFYMCAHNGAGTSRPAHYHVLIDEFSPDDLQNLVHSLSYVYQRSTTAISIVAPVCYAHLAAQQMTQFMKLPR-LQ Lotus_japonicus_LjAGO7 GSVI-SLLANHFLVQFIYHYNIKQKLAYDGRQNLYSS-IEF-QINIK-LV-S-KIDGPQDYLHALD-VVLRESPTGRSFYSIGGGARGFFQSLRPTQGLALNLFS-VTAFHEIGVISYLQKKALKNIRVFVCHQRYRVYGLTEEATENRLVNYFLPCLQISR--SK-PYLPMELCVICEGQKFLGKARILKMGCQRPGERVM-RGNVGSGEQE-REFKLQVSREMTKLTGRILHPPRQWN--LLDGNIERWALVSFGNQLCQLESKLKRIQ-LLICVMER--KLKRIAETSIGLISQCC-QFLANLALKINAKVGGCTVALDEPVIFMGADVTHPPLD-DPSVAAVVGANKYISRIRSQTRQEI--IQDLELLDDFLPNRIVFF-RDGVSETQFHKVMQEELQSIRHACPLITFAVVQKRHHTRLFY-ENIPPTVVDSVITHPKEFDFYLCSHWGVGTSRPTHYHVLWDEFTSDELQKLVYNLCYTFVRCTKPISLVPPAYYAHLAAYRGRLYLELPK-LS Malus_domestica_MdAGO10a GIKC-VVKANHFFAELLNHYDIMAELAYDGRKSLYTA-GEL-PVVIK-FV-A-RANMPQEALQILD-IVLRELSNGRSFFSLGEGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIEFVAQKALRGVKVEVTHRKYRVSGLTSQPTRESVIEYFLPCLQVGN-QKK-AYLPMEACKIVEGQRYTKRTALLKVTCQRPRDRTV-QHN-AYDPYA-KEFGIKISEKLASVEARILPAPGQWN--MMNKKVSRWACINFSSELAQVEKALKHVE-LLLAILPD--NIKRICETDLGLISQCC-QYLANVSLKINVKMGGRNTVLDIPTIIFGADVTHPNGE-DPSIAAVVAVTKYAGLVCAQARQEL--IQDLDLLVSFKPLRIIFYSRDGVSEGQFYQVLLYELDAIRKACPPVTFIVVQKRHHTR?FS-GNILPTVVDTKICHPTEHDFYLCSHAGIGTSRPAHYHVLWDEFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRARFYLELPA-LK Malus_domestica_MdAGO10b GIKC-IVKANHFFAELLNHYDIMAELAYDGRKSLYTA-GEL-P--------------PQEALQILD-IVLRELSNGRSFFSLGEGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIEFVAQKALRGVKVEVTHRKYRVSGLTSQPTRESVIEYFLPCLQ--------------ACKIVEGQRYTKRTALLKVTCQRPRDRTV-QHN-AYDPYA-KEFGIKISEKLASVEARILPAPGQWN--MMNKKVSRWACINFSSELAQVEKALKHVE-LLLAILPD--NIKRICETDLGLISQCC-QYLANVSLKINVKMGGRNTVLDIPTIIFGADVTHPNGE-DPSIAAVVAVTKYAGLVCAQARQEL--IQDLDLLVSFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFIVVQKRHHTRLFS-GNILPTVVDTKICHPTEHDFYLCSHAGIGTSRPAHYHVIWDEFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRARFYLELPA-LK Malus_domestica_MdAGO10c GIKC-IVKANHFFAELLHQYDVMKRLAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTARSFYSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIEFVNEKALRGIKVEVTHRKYRISGLTSQATRESVVEYFLPCLQVGN-QQR-SYLPMEVCKIVEGQRYSRRTALLKVTCQRPYERTV-RQN-AYDPYA-QEFGIKISENLTLVEARILPAPGQWN--MMNKKVNNWMCINFSQELAQVERALKTRE-LLIAILPD--NLKRICETDLGIVSQCCQQYLANVTLKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAITKYAGLVSAQTRQEL--IQDL----------------DGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFSADGLQTLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRARFYMELPA-LK Malus_domestica_MdAGO1a GRRC-TVKANHFFAELLHQYDVMEQLAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTGRSFYALGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIEFVTQKALRGVKVEVTHRKYRISGLTSQATRESVVEYFWPCLQVGN-QQR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPHDRTV-RHN-AYDPYA-KEFGIKISENLAQVEARILPAPGQWN--MMNKKVNNWICINFSNELAQAEKALKTRD-LLVVILPD--NLKRICETDLGLVSQCC-QYLANVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAITKYAGLVCAQARQEL--IQDLELLISFKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADELQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Malus_domestica_MdAGO1b GIKC-VVKANHFFAELLNHYDIMAELAYDGRKSLYTA-GEL-PVVIK-FV-A-RANMPQEALQILD-IVLRELSNGRSFFSLGEGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIEFVAQKALRGVKVEVTHRKYRVSGLTSQPTRESVIEYFLPCLQVGN-QKK-AYLPMEACKIVEGQRYTKRTALLKVTCQRPRDR------------------------------------GQWN--MMNKKVSRWACINFSSELAQVEKALKHVE-LLLAILPD--NIKRICETDLGLISQCC-QYLANVSLKINVKMGGRNTVLDIPTIIFGADVTHPNGE-DPSIAAVKSVTKYAGLVCAQARQEL--IQDLDLLVSFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFIVVQKRHHTR?FS-GNILPTVVDTKICHPTEHDFYLCSHAGIGTSRPAHYHVLWDEFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRARFYLELPA-LK Malus_domestica_MdAGO4 GQKI-PLLTNHFKVAVFFHYSVIDKVAYDGEKSLFTV-GPL-PVLIN-YA-T-KIPMFQEAVRVLD-IVLRQNAARQSFFHLGS-------------------VS-TTMIVKGPVLDFLMLRMLKNLRITTYSMEYKITGLSDRPCKETVSKYFFPCINVGK-PKK-PYFPLELCNLVSLQRYTKSASLVEKSRQKPQERAL-RTS-NYDLML-RSSGVSIGVDFVHVEGRVLPAPGRWN--FNNKKIDRWAIVNFSSNMMKVDKMFEYIQ-LLLCILPE-RKWKRKNLSELGIVTQCI-QYITNVLLKINAKMGGMNSLLKRPTLILGMDVSHGPGR-SPSIAAVVSISRYRAAVRTQSKVEM--IASLELLVDFKPDQIIIF-RDGVSESQFNQVLNVELDQIIEACPKFMLIVAQKNHHTKFFP-DNVPPTIIDNKVCHPKNNDFYLCSHAGMGTTRPTHYHVLYDEFSTDDLQELVHSLSYVYQRSTTAISVVAPICYAHLAAAQISQFIKLPK-LH Malus_domestica_MdAGO5a GEKV-QVRANHFLVEVLHHYDVIKQLAYDGMKSIYTA-GPL-PVTLK-LA-S-KPDLPQDAIQVLD-VVLRAKPSGRSFFALGDGLRGFYQSLRPTQGLSLNIVS-ARAFYEILVTEFVKKKALKGVKVKLSYRSYKITGVSVEPLSKSVVQYYMPALQSGS-DSK-PYLPMELCSIVAGQRYTRKTALLRATCQRPGERMG-KHN-RYDDLI-QQFGMNISQDMALVNARVLPPPGQWN--MINKKVDFWACVNFSEDLVNIERVLRDIQ-LLIIILPD--VIKRICETELGIVSQCC-QYLENLSLKINVKVGGRNTVLDIPTIIFGADVTHPPGE-DPSIAAVVAVTKYRGIVSAQAREEI--IQDLEHFRAFKPERIIFF-RDGVSEGQFSQVLLYEMDAIRKACPPVTFVVVQKRHHTRLFS-GNIQPTVVDTQICHPTEFDFYLNSHAGIGTSRPAHYHVLFDEFTPDALQMLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARYYIELPE-IK Malus_domestica_MdAGO5b GEKV-QVRANHFLVEVLHHYDVIKQLAYDGMKSIYTA-GPL-PVTLK-LA-S-KPDLPQDAIQVLD-VALRATPSGRSFFALGDGLRGFYQSLRPTQGLSLNIVS-ARAFYDVLVTVFVKKKALKGLKVAVSYRSYKISGVSVEPLNKSVEQYYMPALQSGS-DSK-PYLPMELCSIVAGQRYTKKTALLRATCQRPGDRMV-KHN-AYDELVQREFGMHIREDMALVNARVLPPPGQWN--MINKKVDFWACVNFSEDLVNIERVLRDIQ-LLIVILPD--VIKRICETELGIVSQCC-QYLENLSLKINVKVGGRNTVLDIPTIIFGADVTHPPGE-DPSIAAVVAVTKYRGIVSAQVREEI--IQDLEHFRAFIPKRVIFF-RDGVSEGQFSQVLLYEMDAIRKACPPVTFVVVQKRHHTRLFS-GNIQPTVVDTQICHPTEFDFYLNSHAGIGTSRPAHYHVLYDEFTADALQMLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARYYIELPE-IK Malus_domestica_MdAGO7a GTVI-SLLANHFLVQFIFHYHIKQKLAYDGRKNLYSA-LEF-RVNIK-LV-S-KLDAPQDYLHALD-VVLREAPLGRSLYSIGGGARGFFQSLRLTQGLALNVFS-VTAFHEVGVIPYLQKKALKNIRVFVCHQRYRVFGLTEEATEDRLLTYFLPCLQISR--SK-PYLPMELCMICEGQKFLGKARILKMGCQRPKERVM-RGPVGPGIQE-REFKLHVSRDMTRLKGRVLQPPRQWN--LMDSHIERWALISFGRQLSQLESKLKRIQ-LLICVMER--KLKRIADTSVGVLSQCC-QFLANLALKINAKVGGCTVSLDEPVIFMGADVTHPPLD-DPSVAAVVGANKYVSRMRSQTRQEI--IQDLELLNEFLPKRIIFF-RDGVSETQFYKVLQEELQSIKRACPPITFAVVQKRHHTRLFD-ENIPPTVVDTVITHPKEFDFYLCSHWGVGTSRPTHYHILRDEFTSDELQKLVNILCYTYARCTKPVSLVPPAYYAHLAAYRGRLYLELPK-L? Malus_domestica_MdAGO7b GTVI-SLLANHFLVQFIFHYNIKQKLAYDGRKNLYSA-VEF-QINIR-LV-S-KIDAPQDYLHALD-VVLREAPLGRSLYSIGGGARGFFQSLRPTQGLALNVFS-VTAFHEVGVIPYLQKKALKNIRVFVCHQRYRVCGLTEEATENRLLTYFLPCLQISR--SK-PYLPMELCMICEGQKFLGKARILKMGCQRPKERVM-RGPVGPGIQE-REFKLHVSRDMTRLKGRVLQPPRQWN--LINSHIERWALIGFGRQLSQLESKLKRIQ-LLMCVMER--KLKRIADTSVGILSQCC-QFLANLALKINAKVGGCTVSLGEPVIFMGADVTHPPLD-DPSVAAVVGANKYVSRMRSQTRQEI--IQDLELLNEFLPKRIIFF-RDGVSETQFYKVLQEELQAIKGACPPITFAVVQKRHHTRLFD-ENIPPTVVDTVITHPKEFDFYLCSHWGVGTSRPTHYHILWDEFTSDELQKLVNILCYTYARCTKPVSLVPPAYYAHLAAYRGRLYLELPK-LS Malus_domestica_MdAGO9 GKNI-QLTTNHFKVGVFFHYSVVEKVAYDGQKNLFTV-GSL-PVLIN-YA-?-KI?MFQEAVRVLD-IILRQHAVRQSFFRLGEGLSGFHSSFRATQGLSLNMVS-TTVIIKGPVLNFLLERTLKNLRIRIESMEYKITGLSDDSCKETVYDYF-------------P-----LCTLVPLQRYTKASTLVGESRQKPQEREL-RSS-NYDRML-QSSGISISPEFMQVEGRVLSAPGRWN--FSNMSIETWAIVNFSKT?LKVDK----------CII-----WKGK-------------QYITNVLLKINAKLGGMNTYLRSPTMILGMDVSHGPGR-SPSIAAVVGISHYRASVRTQSKVEM--IASLELLLDFKPAQIIIF-RDGTSESQFDQVLNDEMSQIIQACPKFMVIVAQKNHHTKFFP-HNVPPTIIDRTVCHPTNNDFYLCAHAGMGTTRPTHYHVLLDQYSADDL?ELVHSLSYVFQRSTTAISVVAPIRYAHLAAAQMSQFIDLPK-LH Manihot_esculenta_MeAGO1 GTKC-MVKANHFLAEILSHYSIMTQLVYDGGRNLYTA-RSL-PVTIK-FE-A-LASMPQEAITIID-IILREFAAGRSFYSLDGGLRGFYQSIRPTQGLSLNIMS-ATAFIELLVIDFVAQKALRGVKVEVTHRKYRISGLTTQPTRESVVEYFLPCLQVGN-QRK-VYLPMEACKIVQGQRYTKGTSLLKVSCQRPRDQTI-QQN-GYDPYA-KEFGISIDSKLASIEARVLPAPGQWN--MMNKKVRYWACINFSQQLGQVKKALKYVE-LLIAILPD--SLKRICETDLGLISQCC-QYLANVSLKINVKMGGRNTVLDIPTIIFGADVTHPSGE-DPSIAAVVAVTKYAGLVCAQPRQEL--IQDLELLLSFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADEIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAYRARFYMELPA-LK Manihot_esculenta_MeAGO10 GTKC-VVKANHFFAELLNQYDIMAELAYDGRKSLYTA-GQL-PVVIK-FV-A-RANMPQEALQILD-IVLRELSTGRSFFSLGDGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIEFVAQKALRGVKVEVTHRKYRVSGLTSQPTRESVVEYFLPCLQVGN-QKK-AYLPMEACKIVEGQRYTKRTALLKVTCQRPRDRTV-QHN-AYDPYA-KEFGIKISEKLASVEARILPAPGQWN--MMNKKVSRWACINFSNELAQVEKALKHVE-LLLAILPD--NLKRICETDLGLISQCC-QYLANVSLKINVKMGGRNTVLDIPTIIFGADVTHPNGE-DPSIAAVVAVTKYAGLVCAQARQEL--IQDLDLLVSFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFIVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRARFYMELPA-LK Manihot_esculenta_MeAGO4 GQKI-SLLTNHFKVNVFYHYSVIDRVAYDGEKSLFTI-GSL-PVEIS-FA-A-KIPMSQEAIRVLD-IILRQHAARQNFFHVGGGVKGFHSSFRTTQGLSLNIVS-TTMIIQGPVVDFLIARTLKNLRIKASPQEYKITGLSDKPCRETVYDYFLPCINVGK-PKR-PYIPIELCTLVSLQRYTKAASLVEKSRQKPQERAL-KSS-KYEPML-RSCGISISTNFADIEGRVLPAPGRWN--FNNKKIERWAVVNFSRDLTRVEKMFEEIK-FLLCLLPE-RKWKKKNLAEFGIVTQCL-QYLTNLLLKINAKLGGLNSMLKVPTIILGMDVSHGPGH-SPSIAAVVSISRYRASVRTQSKVEM--IDSLELLLDFKPDQIIIF-RDGVSESQFNQVLNIELDQIIEACPKFVVIVAQKNHHTKFFP-DNVPPTVIDNKVCHPRNNDFYLCAHAGMGTTRPTHYHVLLDEFSADDLQDLVHSLSYVYQRSTTAISVVAPICYAHLAATQMGSFMKLPK-LQ Manihot_esculenta_MeAGO5 GMKC-VVKANHFLVQVLCQYDIISELAYDGRKNLYTA-GPL-PVAIK-FA-S-KADLPQETVQVLD-IVLRASPSGRSFFSLGDGIRGYYQSLRPTQGLSFNVVS-ARSFFEIMVTDFVAKKSLKGVKVELHHKSYKITSLSNQPMNQSVVQYFLPALQAGS-DSK-PYLPMELCRIVEGQRYTKKTQLLRATCQRPHDRMV-RRN-NYDELVANEFGIQVKEELALVDARVLPPPGQWN--MINKKVDFWTCVNFSQQLVQIERALADVQ-LLIIILPD--FIKRICETEFGIVSQCC-QYFENVALKINVKVGGRNTVLDLPTIIFGADVTHPPGE-DPSIAAVVAVTKYRGLVSAQAREEI--IQDLELLISFKPGRIIFY-RDGVSEGQFSQVLLHEMDAIRKACPRVTFVVVQKRHHTRLFS-GNILPTVIDTKICHPKEFDFYLNSHAGIGTSRPTHYHVLYDEFTADGLQILTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARYYIELPV-IK Manihot_esculenta_MeAGO7a GSVV-TLVANHFLVQFIFHYNIKEKLAYDGRKNLYSP-VEF-QINIK-LA-S-KLDGPQDYLHALD-VVLRESPMGRSFYSIGGGARGFFQSLRPTQGLALNVFS-VTAFHEIGVIPYLQKITLKNIRVFVCHQRYRVYGLTEEATDNRLVSYFLPCLQISR--SK-PYLPMELCMICEGQKFLGKAKILKMGCQRPKERVM-RGSVGPGKQS-REFKLNVSREMTRLNGRILQPPRQWN--LVDSHIERWALMSFGNQLSQLESKLKKIQ-LLICIMEK--RLKRIAETNVGVVSQCC-QFLANLALKINAKVGGCTVALDEPVIFMGADVTHPPLD-DPSVAAVVGTNKYASRMRSQTRQEI--IQDLELLDEFLPKRIIFF-RDGVSETQFYKVLQEELRAIQEACPLITFAVVQKRHHTRLFG-ENIPPTVVDTVITHPKEFDFYLCSHWGVGTSRPTHYHVLWDEFTSDELQKLVYNLCYTFVRCTKPISLVPPAYYAHLAAYRGRLYLELPK-LN Manihot_esculenta_MeAGO7b GHVI-TLLANHFLVRFIFHYNIKQKLAYDGRKNFYSP-VEF-RINIK-LV-S-KLDGPQDYLHALD-VVLRESPMGRSFYSIGGGARGFFQSLRPTQGLALNVFS-VTAFHEIGVIPYLQKKALKNIRVFVCHQRYRVFGLTEEATDNRLVSYFLPCLQISR--SK-PYLPMELCMICEGQKFLGKAKILKMGCQRPKERVM-RGSVGPGNQS-REFKLHVSREMTRLNGRILQPPRQWN--LADSHIERWALISFGNQLSQLESKLKKIQ-LLICIMEK--RLKRIAETNVGVVSQCC-QFLSNLSLKINAKLGGCTVALDEPVIFMGADVTHPPLD-DPSVAAVVGANKYASRMRSQTRQEI--IQDLELLDDFLPKRIMFF-RDGVSETQFHKVLQEELKSIREACPPITFAVVQKRHHTRLFN-ENIPPTVVDTVITHPKEFDFYLCSHWGVGTSRPTHYHVLWDEFTSDELQKLVYNLCYTFVRCTKPVSLVPPAYYAHLAAYRGRLYIELPK-LS Manihot_esculenta_MeAGOlike GEKC-VVKANHFLVEILCHYDIISQLAYDGRKSLYTA-GPL-PVAIK-FA-S-KANIPQETIQVLD-IVLRESPSGRSFFSLGDGIRGYYQSLRPAQGLSFNIVS-ARSFFEIMVTDFLAKRALRGVKVELSHKSCKIIDLSNQPLNQSVVQYFLPAIQAGS-DSK-PFLPMEVCRIVEGQRYSMKTELLKATCQRPCARIV-MRN-DYDKLVRNEFGIQVKEELTFIDARVLPPPGQWN--MKNKKVEFWTCVNFSRQLIEIERALADVQ-LLIIILPD--VIKRICETELGIVSQCC-PYFENVSLKINVKVGGRNTVLDIPTIIFGADVTHPPGE-DPSIAAVVAVTKYRGNVSAQAREEI--IQDLELCIAFKPNRMIFY-RDGVSEGQFSQVLLHEMDAIRKACPRVTFIVVQKRHHTRLFS-GNIRPTVIDTKICHQNEFDFYLNSHAGIGTSRPAHYHVLYDEFTADKLQVLTNNMCYTYARCTRSVSVVPPAYYAHLAAFRARYYIELPV-IK Marsupenaeus_japonicus_MjAGO2 GRSI-RLRANYYPIEVLIHYDIFDALAYDGMKSAVII-GRI-PVKLK-IV-N-EHNLPSIIFQMMG-IMFRHSPSGQNSFFIGGGKRGFFGSIRPSGPLLLNVVA-HAAFYKQSVLDFIKDKLLKGIKIRVTHRKYRIIGLMEEGAETTVKKYFLNLIRAAP-ETK-TYLPIECCRISKGQRFTKTSQFIRNTARFPSERIV-RMN-KFDPMM-KSLEFTVSDKPVELNGRILPAPGVWE--AWNRQIETWAVFNYDKALRKPEDDFRAIQ-MILVNLPS--KIKKIGDREYGVVTQCI-ATVNNVLLKINGKMGGLNSTLTNPVMIMGADVNHPADDRKPSLAAVVGASSYAVQVRQQFCKEI--INDLNLLIAFKPQRLIMY-RDGVSESQFYTVLANELRAMRKACPGITFIVVQKRHHTRLFS-RNVPPTIVDRVITHPSEIDFYLCSHQGIGTSKPTHYRVLWDDMTMDQLQSMSYALCHTYSRCTRSASIPTPAYYAHLAAYRAKVHGGAVQ-MD Medicago_truncatula_MtAGO10 GTKC-VVKANYFLADILSHYHIIAKLVYDGAENLYTA-GSL-PVAIK-FL-A-HVSMPQEAINAID-IVLKELASGSLHYSLSGGLSGFYQSIRPTQGLSLNVMA-STAFIELPVIDIAAQKALKGVKVEVTYRKYRITGLTSQPTRESVIDYFLPCLQVGS-QKK-VYLPMEACKIVGGQRYTKGTSMLKVSCQRPRERTI-HQN-DYNPYA-KEFGISIGNELASVEARVLPAPGQWN--MTNKKVRYWACINFSQQLVQVKKALKYVE-LVVAILPD--NLKKICETDLGLISQCC-QYLSNVALKINVKMGGRNTVLDVPTIIFGADVSHPSGE-DPSIAAVVAVTKYAGLVCAQPREEI--IKDLELLLSFKPCRILFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDTKICHPTEFDFYLCSHAGVGTSKPAHYHVIWDDFSADEIQSLTNNLCYTYARCTRSVSLVPPAYYAHLAAYRARFYMELPA-LK Medicago_truncatula_MtAGO2 VHTS-TLRVNHFPVKFIFHYNIKEKLAHDGANNIFSA-VQL-PVTIT-LL-N-KLRLPRDILQGMD-VVIKENPVGRYFYPLRPGIGGFHHSLKPTSGLSLCVYS-VVPFRKMSVVDFLHEEVLIGLKVSVTHQKYIIAGLTPTVTRYGLLSFFIPCLDLGK-GNK-KYVPMEFCVLAEGQRYPKEKTLTAMALAHPSERMV-QSSDGPGDLI-QNFGMRVSTTMTTILGRVIGPPCHWN--LSGRSVERWGILDFTEKLIGLSELLEKIQ-FLLCVMAN--KLKWISETKVGIVTQCC-KFYTYLALKINAKLGGSNVELEEHVMFIGADVNHPSRD-NPSIVAVVAANRYAARVCPQFRSEK--ILNFELVSCYRPEKIVVF-RDGVSEFQFDMVLNEELLDLKRAFPTITLIVAQKRHQTRFFS-GNILPTVVDTKVTHPFEFDFYLCSYYGSGTSKPTHYHVLWDEFTSDELQKLIYEMCFTFARCTKPVSLVPPVYYADLAAYRGRLYHEFYR-LH Medicago_truncatula_MtAGO3 IRDC-RLRVNHFPVAFIMHYDIRDKLSYDGEKNIFSS-VPL-PVTIT-LV-N-KLELPRDILQGMD-LVVKENPAGRCFFPLEPGIGGFQHSLKTTAGLALCLYS-VLSFRKMSVLDFLHDEVLLGLKVNVTHQKYTIAKLTDKDTRHSLLAYFIPALDFG--GNK-TFVPMELCVLVEGQRFPKEKNLKNMCLASPRDRMM-KSSDGPGGIL-QNFGMNVNTSMTNVTGRVIGPPCHWN--LVGKSVECWGILDFTNNLMDLCELLEKIQ-FLLCVMAN--KLKWIAETKVGIVTQCC-QYLTNLALKINAKIGGSNVELESHVMFIGADVNHPSRD-TPSIVAVVAANRYAARVCAQECTEK--ILNFDLVRHYRPQKIVIF-RDGVSESQFHMVLGEELKDLKTVFPTITLIVAQKRHQTRLFS-GNVFPTVVDTKVVHPFEFDFYLCSHYGSGTSKPTHYHVLWDEFTSDNLQKLIYDMCFTFARCTKPVSLVPPVYYADLAAYRGRLYYEFYK-LH Medicago_truncatula_MtAGO4a GNKL-SLLTNHFKVNAFFQYNILDKVAYDGEKTLFTM-GSL-AVEIN-YA-S-KIPLYQEALRVLD-TILRQHAARQSFFHVGGGVRGLHSSFRTTQGLCLNIVS-TTMIVQGPVVDFLIARTLKNLRITTMPQEFKITGLSERPCKDTIYEYFLPCINVGK-PKR-PYFPIELCSLVSLQRYTKAASLVEQSRQNPLERAL-QTS-NYEPML-RTCGITIKPHLTQVDGRVLQAPGRWN--FNNKKIANWAVVDFSRDLIKVEKMFQEMK-FILCLLPQ--KWKKKNLAEEGIITQCI-QYLTNVLLKINAKLDGINSFLREPTLILGMDVSHGPGQ-SPSIAAVVSISKYRACVRTQGKVEM--IDNLELLVDFKPANIIIF-RDGVSESQFNQVLNVELGQIIEACPKFLLIVAQKRHHTKFFR-NNVPPTVVDNKICHPRNYDFYMCSHAGRGTTRPTHYHVLLDEFSPDELQEFVHSLSYVYQRSTTAVSVVAPICYAHLAASQVAQFMKLPK-LD Medicago_truncatula_MtAGO4b GAKL-PLLTNHFKVNVFFQYSILDRVAYDGEKTLFTI-GSL-AVEIS-FA-S-KIPLYQEAIRVLD-IILRQHAARQNFFHVGGGVRGLHSSFRTTQGLSLNIVS-TTMIVHGPVVDFLIARTLKNLRITTSPQEYKITGLSEMPCKDTVYDYFLPCINVGK-PKR-PFVPVELCSLVSLQRYTKASSLVEKSRQKPQERAL-KTS-DYEPML-RNCGISITSGFTQVDGRVLQAPGRWN--FNNKKIEKWAVVNFSRDLIKVEKMFEHVK-FLLCLLSE-RKWKKKNLAEFGIVTQCI-QYLTNVLLKINAKLGGMNSLLKAPTLILGMDVSHGPGQ-TPSIAAVVSISKYRACVRTQGKVEM--IDNLELLIDFKPDNIIIF-RDGVSESQFNQVLNIELSQIIEACPKFLVIVAQKNHHTKFFP-DNVPPTVVDNKICHPRNYDFYMCAHAGMGTSRPTHYHVLLDEFSPDDLQELVHSLSYVYQRSTTAISVVAPICYAHLAASQVGQFMKLPK-LM Medicago_truncatula_MtAGO4c GAKL-PLLTNHFKVNVFFQYSILDRVAYDGEKTLFTI-GSL-AVEIS-FA-S-KIPLYQEAIRVLD-IILRQHAARQNFFHVGGGVRGLHSSFRTTQGLSLNIVS-TTMIVHGPVVDFLIARTLKNLRITTSPQEYKITGLSEMPCKDTVYDYFLPCINVGK-PKR-PFVPVELCSLVSLQRYTKASSLVEKSRQKPQERAL-KTS-DYEPML-RNCGISITSGFTQVDGRVLQAPGRWN--FNNKKIEKWAVVNFSRDLIKVEKMFEHVK-FLLCLLSE-RKWKKKNLAEFGIVTQCI-QYLTNVLLKINAKLGGMNSLLKAPTLILGMDVSHGPGQ-TPSIAAVVSISKYRACVRTQGKVEM--IDNL---------------RDGVSESQFNQVLNIELSQIIEACPKFLVIVAQKNHHTKFFP-DNVPPTVVDNKICHPRNYDFYMCAHAGMGTSRPTHYHVLLDEFSPDDLQELVHSLSYVYQRSTTAISVVAPICYAHLAASQVGQFMKLPK-LM Medicago_truncatula_MtAGO4d GAKL-PLLTNHFEVNVFFQYSIIDKVAYDGE-TLFTI-GSL-AVEIN-FA-K-EIPLYQEAIRVLD-IILRQHSARQNFFHVGGGVKGLHSSFRTTQGLSLNIVS-TTMIVRGPVVDFLIERTLKNLRITAKPQEYKITGLSELSCKDTVYDYFLPCINVGK-PKR-PYIPIELCSLISLQRYTKASSLVEKSRQKPVERAL-KAS-NYEPML-RNCGISITSEFTQVDGRVLQAPGRWN--FNNKKLGNWSVVNFSRDLIKVEKMFADVS-FLLCLLPE-RKWKKKNLAEFGIVTQCI-QYLTNVLLKINAKLGGMNSWLKVPTLILGMDVSHGPGQ-PPSIAAVVSISKYRACVRTQGKVEM--IDNLELLLDFRPENIIIF-RDGVSESQFNEVLNVELSQIIEACPKFMVIVAQKNHHTKFFP-DNVPPTVVDSKICHPRNYDFYMCAHAGMGTSRPTHYHVLLDEFSPDDLQELVHSLSYVYQRSTTAISVVAPICYAHLAASQVGQFMKLPN-LH Medicago_truncatula_MtAGO4e GAKI-QLLANHFRVGLFYHYNVIDKLAYDGEKSLFTL-RSL-HVEIS-HV-S-KIPLYQEAFNFLD-TILRQNAAHKSYFHLEGGIRGFHSSFRVTQGLSLNVVS-TTLLVKGPVVDFLLQRMLKNLRIKA--TQRKITGLSEKSCMTTIYEYFMPCINVGK-PKR-PYYPMELCTLVSLQRYTKPAQLILESRTSPRERSL-RNS-RYEPML-RSLGITIEPSFTQVDGRVLQPPGSWN--FNDKKIKRWAIVNFSSMIKKVARMYEMVQ-LLLCILPV-SRWKRRCLVDEGIATQCI-HYIINVLLKINAKLGGMNSFLKIPTLVIGMDVSHGQGQ-SLSIAAVVSISRYKAVVRTQSKVEI--VQSLELLKDFKPQQIIIF-RDGVSESQFNQVLNIELNEIIKACPKFTLIVAQKNHHTRFFPQENVSPTVIDNTICHPKDNDFYMCAHAGRGTSRPTHYHVLYDEFSADNLQEFVHSLCYVHQRSTNAISIVAPIYYADLAAAQIAQFIKLPR-LH Medicago_truncatula_MtAGO6 GKRI-HLLANFFKAAAFSQYNLINRLAYDGERTLYTV-GPL-PVEIS-FA-A-KIPLSQDALRVLD-TVLRQQAARQSFFHVGGGVRGIHSSFRLTEGLSLNMVS-TTTIVKGPVIDFLLSRILKNLRVRATHQEFKISGMSEKPCIQTVYEYFFPCLDVGK-PNR-PFLPLELCSLVPLQRYTKAASLVEKSRQKPQEKAI-GNS-GYDAVL-AACGISIDKQFTPVEGRVLEAPGRWN--FKTKKIGYWAVVNFSRELIKVEKMFSLLK-LILCVLPE-RKWKRKCLSDVGVVTQCI-QYLTNVLLKINSKLGGINSLLDTPTMILGMDVSHGPGR-SPSIAAVVGISRYRASVRSQSKVEM--IDSLELLLDFRPTQIILF-RDGVGESQFQHVLDIELNQIIKAYPKFTVIVAQKNHHTKLFLEKNVPPTVVDTNIVHPRNYDFYMCAHAGMGTSRPVHYHVLLDEFSSDGLQNLINSLSYVNQRSTAATSIVAPIYYAHHAAAQMRKFMNLPK-LH Medicago_truncatula_MtAGO7 GPVI-SLLANHFLVKFIYHYNIKHKLAYDGRKNLYSP-IEF-QINIK-LV-S-KIDGPQDYLHALD-VVLRESPTGRSFYSIGGGARGFFQSLRPTQGLALNVFS-VTAFHEIGVIPYLQKKTLKNIRVFVCHQRYRVYGLTEEATENRLMSYFWPCLQISR--SK-PYLPMELCVICEGQKFLGKAKILKMGCQRPGERVM-RGNVGPGDQE-KEFKLQVSREMTKLTGRILYPPRQWN--FLDGHIERWALISFGNQLTQLESKLKRIQ-LLICIMEK--KLKRIAETSVGVVSQCC-QFLANLALKINAKVGGCTVALDEPVMFMGADVTHPPLD-DPSVAAVVGANKYISRIRSQTRQEI--IADLELLEDFLPNRIIFF-RDGVSETQFYKVLQEELQSIKQACPFITFVVVQKRHHTRLFY-ENIPPTVVDSVITHPKEFDFYLCSHWGVGTSRPTHYHVLLDEFTSDELQKLVYNLCFTFVRCTKPISLVPPAYYAHLAAYRGRLYLELPK-LS Mimulus_guttatus_MgAGO1 GTRC-IVKANHFFAELLHQYDVMAQLAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTGRSFYSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVTQKALRGVKVEVTHRKYRISGLTSQATRESVVEYFWPCLQVGN-TQR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPQERTV-HHN-AYDPYA-KEFGIKISEKLAQVEARVLPPPGQWN--MMNKRVNSWICINFSHELAQVERVLKARD-LLIVILPD--NLKRICETDLGIVSQCC-QYLANVSLKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAVTKYAGLVCAQARQEL--IQDLELLISFKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKACPTVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADALQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPQ-LR Mimulus_guttatus_MgAGO10 GTKC-IVKANHFFAQLLNQYDIIAELAYDGRKSLYTA-GEL-PVAIK-FV-A-RANLPKEALQILD-IVLRELSVGRSFFSLGDGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIEFVAQKALRGVKVEVTHRKYRVCGITTQPTRESVVEYFLPCLQVGN-QKK-AYLPME---------------------------TV-QHN-AYDPYA-NEFGIKISEKMTSVEARVLPAPGQWN--MMNKKVNRWACINFSNELAQVEKALKHVE-LLLAILPD--NLKRICETDLGIISQCC-QYLANVSLKINVKMGGRNTVLDIPTIIFGADVTHPNGE-EPSIAAVVAVTKYAGLVCAQARQEL--IQDLDLLVSFKPQRIIFY-RDGVSEGQFYQVLLFELDAIRKACPPVTFIVVQKRHHTRLFS-GNVLPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRARFYLELPA-LK Mimulus_guttatus_MgAGO4 GNKV-PILTNHFKVNVFFHYSVLDRVAYDGEKSLFTV-GPL-PVEIS-FA-A-KIPMSQEALRVLD-IILRQHAARQSFFHVGGGVRGFHSSFRTTQGLSLNIVS-TTMIIQGDVANFLVARTLKNLRITVSPQEFKITGLSEKSCRETVYDYFLPCINVGK-PKR-PYFPVELCSLVSLQRYTKAASLVEKSRQKPQERAL-KIN-KYEPML-RACGVSINNNFTQVEGRVLPAPGRWN--FNNKRVERWAVVNFSRDLIKVEKMFEEVK-FLLCLLPE-RKWKRKNLSEFGVVTQCL-QYLTNLLLKINAKLGGLNSVLKLPTLILGMDVSHGPGQ-SPSIAAVVSVSRYRACVRTQSKMEM--IDSLEALLDFKPDQIIIF-RDGVSESQFNQVLNIELSQIIEACPKFVVIIAQKNHHTKFFP-DNVQPTVIDNKVCHPRNNDFYLCAHAGMGTTRPTHYHVLLDEFSTDDLQELVHSLSYVYQRSTTAISIVAPICYAHLAATQLGQWMKMPK-LS Mimulus_guttatus_MgAGO5 GQKT-VVKANHFLVSVLNHYDIMNQLAYDGRKSCYTA-GPL-PVSIK-FA-S-KADLPQETIQFLD-VVLREKPSGRSFFHLGNGLKGFYQSLRPTQGLSLNIMS-ARAFFEIYVSEFVFKRALKGVKVENNHKHHKITGLSTEPTQRSVYQYFLPALQAGS-AAR-PYLPMEVCKIVAGQRYSKKTQLLRATCKRPEERMV-EKN-NYDELVNAEFGIQVRPDLLSIEARVLPPPGQWN--MMNKKVDFWTCVNFSNKLLEIEQSLNAIQ-LLLIILPD--VIKRVCETELDIVSQCC-QYLENVSLKINVKAGGRNTVLDIPTIIFGADVTHPPGE-DPSIAAVVAVTKYRGLVSAQGREEI--IQDLEHLVAFKPSRLIFY-RDGVSEGQFNQVLLYEIDAIRKACPRITFVVVQKRHHTRLFS-GNILPTVVDTKICHPNEFDFYLCSHAGIGTSRPAHYHVLYDEFSADALQILTNSLCYTYARCTRSVSIVPPAYYAHLAAFRARYYIELPA-IM Mimulus_guttatus_MgAGO6 GKRI-SLLANHFKVSIFYQYSVIDKLAYDGDASLYTV-GPL-PVEIS-YA-A-KVPLAQDALRVLD-IVLRQDAAGQSFFHVGGGVRGFHSSFRPTLGLSLNMAS-TTLILTGPVVDFLLVKMLKNMRVKARHMEFKIAGLSEKPCNQTVYDYFMPCIDVGK-PKR-PYLPIELCSLVSLQRYTKAASLVEKSRQKPPEKAI-KNS-HYNPVL-VACGISVEKHLSQLDGRILDAPGRWN--FNNKKIDHWALVNFSRELINVEKMVEHIE-FLLCVLPE-RKWKRKCLCNLGIVTQCV-QYLTNVLLKMNSKLGGINSLLDKPTMILGMDVSHGPGR-SPSIAAVVGISRYRAAVRTQSRVEM--IESLELLKDFKPTQIIIF-RDGVSESQFTQVIDIELNQIIKAYPKFTVIVAQKNHHTRLFA-ENVPPTVVDTNIVHPTNYDFYMCSQAGKGTSRPAHYHVLLDEFSPDDMQNLIHSLSYVYQRSTTAISIVAPVCYAHLAAQQMSQFIKLPR-LH Mimulus_guttatus_MgAGO7 ------------------NHN---------------P-VEY----------------PQEYIHALD-VVLREGPTGRSFYSIGGGARGFFQSLRPTQGLALNVFS-VTAFHEIGVIPYLQKKALKNMRVFVCHQRYRVYGLTEKVTEDRLTSYFLPCLQISR--RK-PYLPMELCVICEGQKFLGKAKILKMGCQRPKERVM-KGSFGPGDQG-KEFKLRVSKEMTRLTGRILQPPRQWN--LLDSHVERWAIMSFGNHLSQLESKLKKIQ-LLVCVMER--KLKRIAETRIGIVSQCC-QFLANLALKINAKVGGCTVALEDPVIFMGADVTHPPLD-DPSVAAVVGSNKYVSRMRSQTRQEI--IEDLEILEDFLPTRIVFF-RDGVSETQFHKVMHEELKAIKEACPPITFAVVQKRHHTRLFD-ENVSPTVVDSVIVHPREFDFYLCSHWGVGTSRPIHYHVLWDEFTSDEVQKLVYNLCYTFVRCTKPVSIVPPVYYAHLAAYRGSLYLDLPK-LS Mimulus_guttatus_MgAGO9 GQPI-PLLTNHFKVAVFYHYSILEKVAYDGEKTLFTV-GPL-PVAIN-FA-A-KIPMFQDAVRVLD-IMLRQHASRQSFFHLGGGVRGFHSSFRATQGLSLNMVS-TTMIVKGPVLDFLLARTLKNLRIRATNLEYKISGLSDSICRKTVYDYFFPCINAGK-PKR-PYIPIELCELVSLQRYTKSASLVEKSRQKPMERAL-ATS-NYDPLI-VASGVSISTEFTKIQGRVLPAPGRWN--FNSKRLDRWAVVNFSESIVKVEQMMELIQ-LLLCILPE-KKWKKKNLSDMGIVTQCM-QYTTNLLLKINAKLGGINSLLTVPTLIVGMDVSHGPGR-SPSIAAVVSISKYRAAVRTQSKLEM--IDSLELLQDFKPEQIIIF-RDGVSESQFNQVLNIELEQIIEACPKFMVVVAQKNHHTKFFP-DNVPPTVIDNGICHPRTNDFYMCAHAGMGTTRPTHYHVLFDEFSADALQELVHSLSYVYQRSTTAISVVAPICYAHLAAAQMSQFIKLPL-LH Musca_domestica_MudAGO1like GRPI-VLRANHFQVSMVHHYDIIETMVFDGRNNLYTR-DPL-PVTIK-WM-A-QVSLPYDAILALD-VVMRHLPSGRSFFSLGGGRFGFHQSVRPSQKMMLNIVS-ATAFYKQPVIDFMCEKEIKGLKIEITHRKYRVCNVTRRPAQMTVAKYFLPCLQVGQ-EHK-HYLPLEVCHIVAGQRCIKKSTMIKATARSAPDRLV-KRA-DFDSYV-QEFGLTISNSMMEVRGRVLPPPGVWD--MRGKQIRVWAIACFAQQLQKVEPMFKYLQ-LVVVVLPG--KVKRVGDTVLGMATQCV-QTLSNLCLKINVKLGGINSILNEPVIFLGADVTHPAGD-NPSIAAVVGPSRYAATVRVQQRQEI--IQELELLIMFKPHRIILY-RDGVSEGQFPHVLQHELTAIREACPGITFIVVQKRHHTRLFS-GNIPATTVDVGITHPTEFDFYLCSHQGIGTSRPSHYHVLWDDFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVAIT-VH Nematostella_vectensis_NvAGO1 GRTI-ALRANFFPVQLIHHYDVVEVMVFDGRKNLYTR-DPL-PVTLK-WV-S-QVSLPFETIQALD-VVLRHLPSGRSFFSLERGRFGFHQSIRPSQKMLLNIVS-ATAFYKQSVVEFMCEREIKGLKVEITHRKYRAINVTKQPAQATVARYFLPCLQVGQ-EQR-HYLPLEVCNIVPGQRCVKKSKMIRATARSAPDRLV-KKA-NFDAYV-KDFSISIGKNMVELQGRVLPPPGVWD--MRGRQIRTWAIACFVNQLMKVERMFRRLQ-MILVVLPG--KVKRVGDTMLGVITQCI-QTLSNLCLKINAKLGGVNNILREPAIFLGADVTHPAGD-DPSVAAVVGLSRYYASVRVQTRQEI--IAELELLVQFKPQRIVFY-RDGVSEGQFRQVLVHELKAIREACPGISFIVVQKRHHTRLFS-GNVPPTTVDRGITHPTEFDFYLCSHAGIGTSRPSHYHVLWDDFSADELQALTYQLCHTYVRCTRAVSIPAPAYYAHLVAFRARYHMMAVQ-VH Nematostella_vectensis_NvAGO2 GRKI-KLRANFFQVTLLYHYDVVDAAAFDGRRNLYCR-EPL-PLKIK-EA-G-LVSIPQDAIQGMD-IVLRQMPSGRCFFPLGGGCTGFYQSVRPSQTMLLNIVS-SKGFQKMPVIDFMLETEIKGLRVETTHRKFTVMGLSHPAFNNTVEAYFLPCLLVGQ-KKN-S-VPMEVCNMIPTQR--KRAAMIRKTAKPANERWV-DEL-ATDQYLKNEYGMRINKQMVAIEGRVLPAPGAWD--MRGKSVEVWALVCFSRQMGNVEGIFGKLQ-LIVVALPD-RGVKRVGDTVLGIPTQCV-QVCSNIAMKINGKLGGTNHVINSLVIIFGADVTHPPGD-MLLSPPYVAASRYCARVRPQTAQEI--IVDLELMIEFKPVRIIFY-RDGVSEGQFQQVLLEEVRAVQQACPLITFVAVQKRHHARLFS-RNVPATTVDTVICHPFEFDFYLCSHAGIGTSRPTHYHVLYDDFSADKLQALTYQLCHTFARCTRSVSMPAPAYYAHLAAFRARGLVNLSELVK Nicotiana_attenuata_NaAGO10 GTKC-IVKANHFLAELLNQYDILAELAYDGRKSLYTA-GEL-PVVIK-FV-A-RANVPQEALQILD-IVLRELSIGRSFFSLGDGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIEFVAQKALRGVKVEVTHRKYRVSGLTSQPTRESVVEYFLPCLQVGN-QKK-AYLPMEACKIVEGQRYTKRTALLKVTCQRPRDRTV-QHN-DYDPYA-KEFGIKISEKQASVEARVLPAPGQWN--MMNKKVSRWACINFSNELAQVEKALKHVE-LLLVILPD--NIKRICETDLGLISQCC-QYLANVSLKINVKMGGRNTVLDIPTIIFGADVTHPNGE-DPSIAAVVAVTKYAGLVCAQARQEL--IQDLDLLVSFKPQRIIFY-RDGVSEGQFYQVLLFELDAIRKACPPVTFIVVQKRHHTRLFS-GNILPTVVDTKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRARFYMELPA-LK Nicotiana_attenuata_NaAGO1a GIRC-IVKANHFFAELLHQYDVMEQLAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPMGRSFYSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPIIDFVSQKALRGVKVEVTHRKYRISGLTSQATREAVVEYFLPCLQVGN-TQR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPQERTV-HHN-AYDPYA-KEFGIKISEKLAQVEARVLPAPGQWN--MMNKKVNNWICVNFSSELAQVERVLKTRD-LLIVILPD--NLKRICETELGIVSQCC-QYLANVSLKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAITKYAGLVSAQARQEL--IQDLELLISFKPQRIIFY-RDGVSEGQFYQVLLFELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADALQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Nicotiana_attenuata_NaAGO1b GMRC-IVKANHFFAELLHQYDVMAQLAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPTGRSFYSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVTQKALRGVKVEVTHRKYRISGLTSQATRESVIEYFWPCLQVGN-QQR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPQERTV-HHN-AYDPYA-KEFGIKISDKLAQVEARILPPPGQWN--MMNKKVNNWICINFSSELAQVERVLKTRD-LLVVILPD--NLKRICETELGVVSQCC-QYLANVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAITKYAGLVSAQARQEL--IQDLDLLISFKPQRIIFY-RDGVSEGQFYQVLLFELDAIRKACPPVTFVVVQKRHHTRLFS-GNIIPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADALQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Nicotiana_attenuata_NaAGO1c GIRC-TVKANHFFVELLHQYDVMEQLAYDGRKSLYTA-GPL-PVVIK-LA-S-RADLPQEALQVLD-IVLRELPTARSFYSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVTQKALRGVRVEVTHRKYRISGLTSQATRESVVEYFWPCLQVGN-QQR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPQQRTV-RHN-AYDPYA-KEFGIKISERLAQVEARILPAPGEWN--MKNKKVSNWICINFSSELAQVERVLKTRD-LLIAILPD--NLKRICETDLGIVSQCCQQYLANVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAITKYVGLVSAQARQEL--IQDLELLISFKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADALQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYLELPS-LK Nicotiana_attenuata_NaAGO2 VKSI-RLLANHFPVRFIMHYDIRDKLAYDGEKNIFSA-VQL-PFTIK-FV-A-ELKLPRDVLQGMD-LVMKENPSGRSFYSFGFGVRGFQQSLKPTSGLALCLYS-VLAFRKVPVLDFLREDALVGLKVKVTHQKYVVKKLTDEKTRDFLVDYFLPSLDLGK-GNK-KYVPMEFCVLIEGQRYPKELFMKKISLVPPRERMV-RAEDGPGAVT-RNFEIGVDRNMTCVSGRILPAPCQWN--LVGKSLQRWALIDFSFRLKEVEDLLRGVQ-MIVCVMAA--KLKWVSETKIGVVTQCC-QYLANLCIKINAKLGGSNMELEDNVMFIGADVNHPARN-VPSIAAVVAANRYAARVCPQDRTEK--ILNFDLLNAYKPNRIVVF-RDGVSEGQFDMVLNEELVDLMKAIPAITLVVAQKRHHTRLFP-GNVPPTVVDTVIVHPSDFDFYLCSHFGGGTSKPTHYHVLWDEFNSDRLQKLTYNMCFTFARCTKPVSLVPPVYYADLVAYRGRMFQEFYN-LH Nicotiana_attenuata_NaAGO4a GQKI-PILTNHFKVNVFFHYSVLDRVAYDGEKSLFTI-GSL-PVEIS-FA-A-KIPMSQEALRVLD-IILRQHAARQSFFHVGGGVRGFHSSFRTTQGLSLNIVS-TTMIIQGPVVDFLIARTLKNLRVKTAPQEFKITGLSEKSCRETVYDYFLPCINVGK-PKR-PYFPVELCSLVSLQRYTKASSLVEKSRQKPQERAL-KTN-NYEPLL-RASGISISSNFTQVEGRVLPAPGRWN--FNNKRVERWAVVNFSRDLTRVEKMFEEIK-FLLCLLPE-RKWKRKNLADYGIVTQCL-QYLTNLLLKINAKLGGLNSVLKVPTMILGMDVSHGPGQ-SPSIAAVVSISRYRASVRTQSKVEM--IDNLELLLDFKPEHIIIF-RDGVSESQFNQVLNIELDQLIEACPKFVIIVAQKNHHTKFFP-DNVPPTIIDNKVCHPRNYDFYLCAHAGMGTTRPTHYHVLLDEFSPDDLQDLVHNLSYVYQRSTTAISIVAPVSYAHLAATQVGQWMKLPR-LQ Nicotiana_attenuata_NaAGO4b GQKI-QILTNHFKVNVFYHYSVLDRVAYDGEKSLFTI-GAL-PVEIS-FA-A-KIPMSQEALRVLD-IILRQHAARQSFFHVGGGVRGFHSSFRTTQGLSLNIVS-TTMIIQGPVVDFLIARMLKNLRVKTSPQEYKITGLSERSCKETVYDYFLPCINVGK-PKR-PYFPIELCNLVSLQRYTKSSSLVEKSRQKPQERAL-KIN-KYEPLL-RACGISISSNFTQVEGRVLSPPGRWN--FNNKRIERWAVVNFSSDLIKVEKMFEEVK-FLLCLLPE-RKWKRKNLAEFGIVTQCI-QYITNVLLKINAKLGGLNSMLKVPTIILGMDVSHGPGQ-SPSIAAVVSISRYRASVRTQSKVEM--IDNLEALLDFKPEHIIIF-RDGVSESQFNQVLNIELDQIIEACPKFTVIIAQKNHHTKFFP-NNVPPTIIDNKVCHPRNYDFYLCAHAGMGTTRPTHYHVLYDEFSPDDLQELVHNLSYVYQRSTTAISVVAPICYAHLAATQMGQWMKLPK-LE Nicotiana_attenuata_NaAGO5 GRKC-LIRANHFLVHVLHHYDIMSQLAYDGGKSVYTA-GPL-PVSIK-FA-A-KADLPQETIQALD-VVLRASPSGRSFFHLTDGLKGYYQSLRPTQGLSLNIMS-ARAFYEIYVYEYVARRVLKGVKVEVSHRRYRISGLSAQPVKESVVDYFLPAIQAGS-DAK-PYLPMEICRIVPGQRFTKMTEMLKATCQRPVDRIV-SSN-NYDEMV-KEFGIEVRSELTTIEARVLQPPGQWN--MINKKVDTWTCVSFSKALIEIEKTLVDIQ-LLIVILPE--VIKRVCETDLGIVSQCC-QYLENLALKINVKVGGRNSVLDIPTIVFGADVTHPPGE-DPSIAAVVAVSQYRCLVSAQPRKEI--IEDLELLIAFKPGRIIFY-RDGVSEGQFNQVLLEEMDAIRKACPRVTFVVVQKRHHTRLFS-GNILPTVVDTKICHPMEFDFYLCSHAGIGTSRPTHYHVLFDEFTADAIQNLTNFLCYTYARCTRSVSIVPPAYYAHLAAFRARYYLELPK-IK Nicotiana_attenuata_NaAGO7 GQVI-SLLANHFLVKFIFHYDIKQKLVFDGGRTIYSP-IEF-QVNIK-LI-S-KFDGPQEYLHALD-VVLRESPTGRSFYSIGGGARGFFQSLRPTQGLALNVFS-VTAFHEIGVIPYLEKKALKNIRVFVCHQRYRICSLTEEVTENRIVNYFLPCLQISR--SK-PYLPMELCMICEGQKFLGKARILKMGCQRPRERIV-TGSVGPGNHA-RDFKLQISREMTPLYGRILQPPRQWN--LLDSHIERWALMSFGNQLCQLETKLKKLQ-LVICVMEK--KLKRIAETNIGVVTQCC-QFLANLALKINAKVGGCTVALDGPVIFMGADVTHPPLD-DPSVAAIVGANKYVSRMRSQTRQEI--IQDLEILDDFLPERIIFF-RDGVSETQFLKVLKEELQAIRVACPPITFVVVQKRHHTRLFN-ENIPPTVVDSVITHPREFDFYLCSHWGVGTSRPIHYHVLWDEFTSDELQKLVYNLCYTFVRCTKPISLVPPAYYAHLAAYRGRLYLELPK-LT Nicotiana_attenuata_NaAGO8 GRGI-ALLANHLKVSVFYQYSIIDKIAYDGEKSLYTV-GPL-PVEIN-FA-A-KIPLVQDALRVLD-IILRQQAAKQSFFHVGGGVKGLHSSFRPTLGLTLNMVS-TTMILSGPVIDFLLTRMLKNLRVKAKHKEFKIVGLSERPCNQTVYEYFMPCLDVGK-PKR-PYLPLELCYLVSLQRYTKAASLVEKSRQKPRERAV-RDY-SYDPLL-ATCGVSIEKQLIQFNGRVLEAPGRWN--FNNKHIERWAVVNFSRELISVEKMFEEID-FLLCVLPE-RKWKKKSLTDLGIVTQCI-QYLTNVLLKINAKLGGTNSLLDTPTMILGMDVSHGPGQ-SPSIAAVVGISKYRAVVRSQSKLEI--IESLELLLDFKPAQIIVF-RDGVSESQFSQVLNLELDQMIKAYPKFTLIVAQKNHHTKLFP-ENVPPTVVDTNIVHPRNNDFFMCAHAGMGTTRPAHYHVLLDEFSPDVLQNLIHSLSYVYQRSTTATSIVAPVRYAHLAAQQFAQFVKLPR-LH Nicotiana_attenuata_NaAGO9 GQKI-RLLTNHFKVGMFFHYSILDKVAYDGEKSLFTI-GAL-PVVIK-YA-A-KIPMYQETVRVLD-IVLRQHAARQSFFHLGGGVRGFHSSFRATQGLSLNMAS-TTMIVQGPVVDFLLAKMLKNLRIKASPREYKITGLTEKPCKETVYEYFFPCINVGK-PKH-PFIPLELCHLVSLQRYTKAASLVEKSRQKPQERAL-KTS-NYDPLL-GSAGISISDQFTQVEGRILPTPGRWN--FNQKQLERWAVVNFSMDLQRVEKMLEAVQ-FLLCILPE-RKWKRRNLSDLGIVTQCI-QYLTNVLLKINAKLGGMNSFLKVPTIIIGMDVSHGPGR-APSIAAVVSISRYRAAVRTQSKLEM--IDSLELLVDFKPEHIIIF-RDGVSESQFNQVINTELDQIIEACPKFTVVVAQKNHHTKFFP-DNVLPTVIDNAICHPKNNDFYMCAHAGPGTTRPTHYHVLHDEFSADDMQELVHSLSYVYQRSTTAISVVAPICYAHLAAAQMSQFIKLPR-LH Nicotiana_benthamiana_NbAGO1.1 GIRC-IVKANHFFAELLHQYDVMEQLAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPTGRSFYSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPIIDFVSQKALRGVKVGVTHRKYRISGLTSQATREAVVEYFWPCLQVGN-TQR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPQERTV-HHN-AYDPYA-KEFGIKISEELAQVEARVLPAPGQWN--MMNKKVNNWICVNFSSELAQVERVLKTRD-LLIVILPD--NLKRICETELGIVSQCC-QYLANVSLKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAITKYAGLVSAQARQEL--IQDLELLISFKPQRIIFY-RDGVSEGQFYQVLLFELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADALQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Nicotiana_benthamiana_NbAGO1.2 GMRC-IVKANHFFAELLHQYDVMAQLAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPTGRSFYSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVTQKALRGVKVEVTHRKYRISGLTSQATRESVIEYFWPCLQVGN-QQR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPQGRTV-HHN-AYDPYA-KEFGIKISDKLAQVEARILPPPGQWN--MMNKKVNNWICINFSSELAQVERVLKTRD-LLVVILPD--NLKRICETELGVVSQCC-QYLANVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAITKYAGLVSAQARQEL--IQDLDLLISFKPQRIIFY-RDGVSEGQFYQVLLFELDAIRKACPPVTFVVVQKRHHTRLFS-GNIIPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADALQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Nicotiana_benthamiana_NbAGO4.1 GQKI-PILTNHFKVNVFFHYSVLDRVAYDGEKSLFTI-GSL-PVEIS-FA-A-KIPMSQEALRVLE-IILRQHAARQSFFHVGGGVRGFHSSFRTTQGLSLDIVS-TTMIIQGPVVDFLIARTLKNLRVKTAPQEFKITGLSEKSCRETVYDYFLPCINVGK-PKR-SYFPVELCSLVSLQRYTKASSLVEKSRQKPQERAL-KIN-NYEPLL-RASGVSISSNFTQVEGRVLPAPGRWN--FNNKRVERWAVVNFSRDLTRVEKMFEEIK-FLLCLLPE-RKWKRKNLADYGIVTQCL-QYLTNLLLKINAKLGGLNSVLKVPTMILGMDVSHGPGQ-SPSIAAVVSISRYRASVRTQSKVEM--IDNLELLLDFKPEHIVIF-RDGVSESQFNQVLNIELDQLIEACPKFVIIVAQKNHHTKFFP-DNVPPTIIDNKVCHPRNYDFYLCAHAGMGTTRPTHYHVLLDEFSPDDLQDLVHNLSYVYQRSTTAISIVAPVSYAHLAATQVGQWMKLPR-LQ Nicotiana_benthamiana_NbAGO4.2 GQKI-QILTNHFKVNVFFHYSVLDRVAYDGEKSLFTI-GAL-PVEIS-FA-A-KIPMSQEALRVLD-IILRQHAARQSFFHVGGGVRGFHSSFRTTQGLSLNIVS-TTMIIQGPVVDFLIARMLKNLRVKTSPQEFKITGLSDRPCRETVYDYFLPCINVGK-PKR-PYFPIELCNLVSLQRYTKSSSLVEKSRQKPQERAL-KIN-KYEPLL-RACGISISSNFTQVEGRVLSPPGRWN--FNNKRIERWAVVNFSSDLIKVEKMFEEVK-FLLCLLPE-RKWKRKNLAEFGIVTQCI-QYITNVLLKINAKLGGLNSMLKVPTIILGMDVSHGPGQ-SPSIAAVVSISRYRASVRTQSKVEM--IDNLEALLDFKPEHIIIF-RDGVSESQFNQVLNIELDQIIEACPKFTVIIAQKNHHTKFFP-NNVPPTIIDNKVCHPRNYDFYLCAHAGMGTTRPTHYHVLHDEFSPDDLQELVHNLSYVYQRSTTAISVVAPICYAHLAATQMGQWMKLPK-LE Nicotiana_tabacum_NtAGO1 GIRC-IVKANHFFAELLHQYDVMEQLAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPTGRSFYSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPIIDFVSQKALRGVKVEVTHRKYRISGLTSQATREAVVEYFLPCLQVGN-TQR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPQERTV-HHN-AYDPYA-KEFGIKISEKLAQVEARVLPAPGQWN--MMNKKVNNWICVNFSSELAQVERVLKTRD-LLIVILPD--NLKRICETELGIVSQCC-QYLANVSLKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAITKYAGLVSAQARQEL--IQDLELLISFKPQRIIFY-RDGVSEGQFYQVLLFELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADALQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Nilaparvata_lugens_NlAGO1 GRPI-VLRANHFQITMVHHYDIIETMVFDGRSNLYTR-DPL-PVAIK-WL-A-QVSLPYDAILALD-VVMRHLPSGRSFFSLGGGRFGFHQSVRPSQKMMLNIVS-ATAFYKQPVIEFMCEKEIKGLKIEITHRKYRVCNVTRRPAQMTVAKYFLPCLQVGQ-EHK-HYLPLEVCNIVAGQRCIKKSTMIKATARSAPDRLV-RRA-DFDAYV-QEFGLTISNNMMEVRGRVLPPPGVWD--MRGKQIRVWAIACFAQQLQKVEPMFRYLQ-LVVVVLPG--KVKRVGDTVLGMATQCV-QTLSNLCLKINVKLGGINSILNEPVIFLGADVTHPAGD-NPSIAAGGGPSRYAATVRVQQRQEI--IQELELLIMFKPHRIILY-RDGVSEGQFLHVLQHELTAIREACPGITFIVVQKRHHTRLFS-GNIPATTVDVGITHPTEFDFYLCSHQGIGTSRPSHYHVLWDDFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVAIT-VH Nilaparvata_lugens_NlAGO2 GRRI-ELELNHFELTFAIHYDIMEAFAFDGRKNLYSA-KEL-PVTVK-FA-S-KVDMPQEALQAID-IVLRNPAAGRSFFTLGEGLYGFYQSAILGWKPFLNVVA-HKGFPMEQLLQTLCRKYIKGLKVEYQIRVYKVNKLVKNAIEQTVGEYFLPLVHIGP-LNK-EFVPLEMCMITRGQALNRKAEMVRNAAKPPDERAL-RKA-NFDKCV-QEFGIHVSDRFAEVNGRVLEPPGVWR----SGRIKNWAIINCDTEMSVFGSLLSNLE-IVIVVIPE---VKQTAELSVGILTQCI-ATIGNILLKVNSKLNGLNHKLARPAMIMGADVTHPPDQ-VPSVAAVSAGFMYNMMWRLQPKTEI--IEDLAQLKYFKPETIYFF-RDGVSEGQFNQVLSAELTAIRKACPGITFLVVQKRHHTRFFF-GNVPATIVDTQICHKSETDFYLVSHASIGTARPTKYHLLWDDIDEDDLEELTYSLCHLFTRCTRSVSYPAPTYYAHLAAFRARVYLEVIE-VN Oikopleura_dioica_OdAGO2 GKQI-VLKANYFKVNILHHYDIIENMVFDGRRNMYTA-HPL-PVAIK-WV-A-RVSLPFETIQALD-VVMRHLPSGRSFFSLGGGRFGFHQSMRPSQKMMLNIVS-ATAFYRQSVIDFMCEKEIKGLKVEITHRKYRVCNVTRRPASHTVARYFLPCLQVGQ-EQK-HYLPIEVCNIVAGQRCIKKSTMIKATARSAPDRLV-SNA-GFDPYV-REFGIEVIDVMTEVRGRVLPAPGVWD--MRGKQINVWAIACFARSLQRVEPMFKYLQ-LIVVVLPG--KVKRVGDTCLGIATQCV-QTLSNLCLKINVKLGGINNILQEPVIFIGADVTHPAGD-KPSIAAVVAPSRYCAAVRVQKRQEV--IDDLELMIQFKPVRIIIY-RDGVSEGQFQTVLAHELRAIREACPGITFVVVQKRHHTRLFS-GNIPATTVDVGICHPTEFDFYLCSHAGIGTSRPSHYHVLWDDFTADELQVLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVAVL-VH Oryza_sativa_OsAGO11 GTSC-RVRANHFVVQLIYHYDIINELAYDGRKGMFTA-GAL-PVTIK-CA-G-AANLDRFSHKHLD--------------------------IRILIALNGGEIS-ATTFYKQPVIDFALD---------------------------SVVQYFWPCLQAGS-DSR-PYLPMEVCRIVKGQRYSRKTRMLRLARETPEERIA-NEN-NYDYHA-REFGIGVTNQLALVDARVLPAPGQWN--MNNKRINYWACLTFAKELVRLDAAVRDIE-LLVIVLPD--AIKRLCETELGVITQCC--------------VGGRNTVLDMPTMIFGADVTHPAGE-DPSIAAVVAVSKYKCSVSSQSREEI--IADLELIESFKPGRIIFY-RDGVSEGQFSQVLLSEMDAIRKACPPVTFVVVQKRHHTRLFS-RNILPTVVDTKICHPSEFDFYLCSHSGIGTSHPTHYYVLFDEFSADALQTLTYHLCYTYARCTRSVSIVPPVYYAHLAASRARHYLELPE-IK Oryza_sativa_OsAGO12 GRRC-RVRANHFLVQVIYHYDIINKLVYDGRKSIYTA-GPL-PVTIK-QA-S-KTDLPQDTIQALD-IALRECPTSRSFFSIGSGTRGYYQSLRPTQGLSLNIIS-ATAFYKQPVMDFAVQKALKGVQIVATHIRYKITGIPSAPMNESVVQYFWPCLQAGS-DSR-PYLPMEVCSILEGQRYSKKTNILRMTCERPAQRIV-NTN-SYDDCA-KEFGIKVANQLAVVDARVLPTPGQWN--MINKRINHWTCLSFAEDLVGIEGAIRNIQ-LLIVILTE--IIKRICETEVGVITQCC-QYLENLALKMNVKVGGRNTVLDRPTIVFGADVTHPPGE-DPSIAAVVAVTKYKCLVSTQSREEI--ISNLELLRSFKPSRIIFY-RDGISEGQFSQVLLYEMDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDTMICHPSEFDFYLCSHSGIGTSRPTHYHVLLDEFKADTLQTLTYNLSYTYARCTRAVSIVPPAYYAHLGAFRARYYMELPE-IK Oryza_sativa_OsAGO13 ---------------------------------------------------------PQETIQ------------------IGEGLRGYYQSLRPTQGLSLNIIS-ATSFFKVTVIQFVEEKALRGVRIETNHRRYKITGITPIPMSQTVVQYFWPCLQSGS-DSR-PYLPMEVCKIVEGQRYSKKTNILRATCQRPQQRMV-LHN-KYDRFA-QEFGIK----------------GQWN--MINKKVDNWTCLSFSGDLIQIENALRDVQ-LLIVILLE--VIKRVCENDLGIVSQCC-QYLENVALKINVKKSQQSSLV----------MSHTPGE-DSSIAAVVAITKYRGLVSAQSRQEI--IEDLEFLIAFRPERIIFY-RDGVSEGQFSRVLLHEMDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVKDRQICHPTEFYFYLCSHAGIGTSRPTHYHVLYDEFTADELQTLTNNLCYIYARCTHAVSVVPPAYYSHLAASHAHCCIKAPT-LQ Oryza_sativa_OsAGO14 GERI-VVRANHFLVRVIYLYDVMSELAYDGSKALYTA-GKL-PVTIR-RA-G-QADLQQQTIQALD-VVLRESPSSRSFYSIGDGLKGYYQSLRPTQGLSLNIIS-STPFFKISVVEYVKNKALRGVRVETTHSKYKITTITSEPLSQTVIQYFWPCLQSGN-PSN-PYLPMEVCTIVEGQRYSKKTGLLRATCQPPQKRMV-QHN-NYDKVV-SDFRINISNQMATMPARVLPAPGQWN--MINKKVQKWTCVNFSGELVYIEAALSNIQ-LLIVILPD--VIKRVCETELGIVSQCL-QFLENVSLKINVKAGGRNSVLENTTIIFGADVTHPSGE-DASIAAVVAITKYKALVSAQPRQEI--IQDLELLMSFKPQRIIFY-RDGVSDGQFLHVLLYEMDAIKKAIPLVTFVVVQKRHHTRLFS-GNVRPTVVDTNICHPSEFDFYLCSHAGIGTSRPTHYHVLHDEFSADQLQMLTYNLCYTYARCTRSVSVVPPAYYAHLAAFRARYYDELPQ-IK Oryza_sativa_OsAGO17 GESC-IVRTNCFSVHLIYEYDVIRELAYDGRKRLYTS-GPL-PVTLK-FA-A-KISLSRAALRALD-VVLKELPTAGSFYSLCKVLRGFHQRIQATQGLQLNIVS-SSVFIKVPVVDYVAQEALEGLKVQINGNTYHVQDLVHQAAS-------LPCLKVAH-FGE-TFLPLEVCKIAEGQCHQKQAALLQVARQPPNERTV-HQN-KYDPHA-KEFGIKIEEKLVSIKSRILPAPGIWN--MMHKKVKSWACVNFCYDLGFVESALRTLD-LLIVILPN--NVKRICETDIGLISQCC-WYLASVALKINAKMGGRNTVLDTPTIVFGAHVTHPPGK-ASSIAAVVAVTKYAGLISVQAHQES--IQGLEHLMSFKPGRIIFY-RDGVSKGQLPQALMHELGAIKMACPLVTYVVLQKCRHTRLFT-ANIRATVVDSNICQPNQFDFYLCSHRSTGTKRPRYYHVLWDEFLAGSFQELTNYLCYTSATCTQSISVVAPVHYARLLSSRARCYIKLLP-IK Oryza_sativa_OsAGO18 GEEC-LVKVNHFFVGLFHHYDIISKLVYDGRANLYTA-GEL-PVAIR-HV-A-PVSLPSQALQLLD-IVLRDMVLGRSYFSLDKGIKGFYQSCRVTQGLSLNIMS-STAFIEGRVLNFVEKRTLKGVKVEVTHKKYRIAGFTEQSADVTVKEYFLPCLQVGS-KER-PYLPMELCNIVPGQRYKNRSNLINITNDRPCDRTV-SSN-QYTERA-DEFGIEVDSYPTTLKARVLKAPGAWN--MKDKKIKSWACVNLCLQLVRVKTDLPMRD-LLLVVMTDDKNVKRICETEIGVLSQCC-QYCANVALKINAKAGGRNSVFKSPTIIFGADVTHPSFD-EPSIASVVAVTKYNSVVRMQARKEI--IQDLELLNAFEPKQLIFY-RDGVSEGQFQQVVESEIPEIEKAWPRITFIVVQKRHHTRLFT-GNVRPTVVDTVICHPREFDFFLCSQAGIGTSRPSHYHVLRDDFTADQLQSVTNNLCYLYTSCTRSVSIPPPVYYAHKLAFRARFYLTLPE-IK Oryza_sativa_OsAGO1A GDRC-IVKANHFFAELLHQYDVIGEIVYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTARSFYSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVAQKALRGVKVEVTHRKYRISGLTSQATRETVVQYFLPCLQVGN-QQR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPQERTV-HHN-AYDPYA-QEFGIRIDERLASVEARVLPPPGQWN--MMNKKVNNWTCINFSRELAIVERALKARD-LLIAILPD--NLKRICETDLGLVSQCC-QYLANVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAVTKYAGLVSAQARQEL--IQDLELLISFKPQRIIFY-RDGVSEGQFYQVLFYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGLQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPD-LK Oryza_sativa_OsAGO1B GDRC-IVKANHFFAELLHQYDVMFELAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTGRSFYSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVAQKALRGVKVEVTHRKYRISGLTSQATRETVVQYFLPCLQVGN-QQR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPQERTV-SHN-AYDQYA-QEFGIKIDERLASVEARVLPPPGQWN--MMNKKVNNWACINFSHELAIVERALKARD-LLIVILPD--NLKRICETDLGLVSQCC-QYLANVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAVTKYAGLVSAQARQEL--IQDLELLISFKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADELQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Oryza_sativa_OsAGO1C GTRC-MVKANHFFAHLLHHYDVIKELAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPSGRSFFSLGEGLRGFYQSIRPTQGLSLNIMS-ATAFIELPVIDFVAQKALRGVKVEVTHRKYRISGLTIQPTRESVVQYFLPCLTV----QR-LYLPMEVCKIVEGQRYSKRRALLEETCQHPRDRMV-KHN-AYDPYA-KEFGIKISDRLASVEARILPAPGQWN--MMNKKVRSWMCVNFAHELALVERALKARD-LLIGILPD--NLKRVCEIDLGIVSQCC-QILANLALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAVTKYAGLVSAQARQEL--IEDLELLISFKPQRIIFY-RDGVSEGQFYQVLLYELNAIRKACPKVTFIVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADALQILTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Oryza_sativa_OsAGO1D GTRC-LVKANHFFAQLLHQYDVMEELAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTGRSFFSLGEGLRGFYQSIRPTQGLSLNIMS-ATAFFELPVIDFVIQKALRGVKVGVTHRKYRISGLTSQATRESVVQYFLPCLQVGN-QQR-PYLPMEVCKIVEGQRYSKRRALLEETCQRPHDRMV-NHN-SYDPYA-KEFGIKISERLALVEARILPAPGQWN--MMNKKVRSWICVNFARELARVERALKARD-LLIGLLPD--NLKRICEIDLGLVSQCC-QILANLALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAVTKYAGLVSAQSRQEL--IDDLELLISFKPQRIIFY-RDGVSEGQFYQVLLHELDAIRKACPQVTFIVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFFLCSHAGIGTSRPAHYHVLWDEFTADALQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Oryza_sativa_OsAGO2 KAKV-KLLVNHFIVKYVFHYDVKDELAYDGKRNLFTC-AEL-PVSVE-FK-K-KLPLPREVLQGLD-VIVREASSGQGFYSIGPDVKGTQQTLKCTQGLILCVYS-VMPFRKGPVLDLVQKNELKGQRVTVNHQKYIVKGLTDKPASQKLLDYYLPCLDLSKSKDK-QYVPIELCDLLEGQRYPKAKTLKEMALIPASSRLV-NADDGPGEIA-QQFGISLDVQMMEVTGRTLPPPCQWN--LTRKRLQCWGVVDFSDKIVRLFEELNKAQ-LLFCPMSD--QLKLICETQLGIQTQCF-QYMSNLALKINGKIGGSNIQLGAPYMFIGADVNHPPGN-VPSIAAVVAASKYVPRIRAQPRCEV--IQHLELIGVFKPQRIIYF-RDGVSDGQFDMVLNEELADMEKAIPTITVIVAKKRHHTRLFN-GNVLPTVVDTGVVDPAAYDFYLCSHNGLGTSRPTHYYSLLDEFASDDLQKLVYNLCFVFARCTKPVSLATPVYYADLAAYRGRLYYEFPA-LH Oryza_sativa_OsAGO3 KGEV-KLLVNHFSVDYFFHYEVKNELAYDGERNLYTC-AEL-PVSVK-LK-K-PLPLPRDVMQGLD-VIVREASSGQGFYPSDSNIKGTQQSLKCTQGLILCVYS-VLPCWKGSVLDLVKTNALKGLCVTVSHEKYTVKGLTDKPADQKLIEYYLPCLDLSKSKSK-QYVPIEFCNIPEGERYPVATTLRKISIKVASSRLVGNAQDGPGKIA-QRFRISLDAAMMEVTGRILAPPCQWN--WKLKKLNCWGVVDFSDKVVRLRDALIEAQ-LLFCPMLN--RLKLMCETELGIQTQCF-QYITNLALKINGKIGGSNMQLAKDFMFIGADVNHPPGNVSPSIAAVVAASKYVTRIRAQYRCEM--IQNLELIGAYKPDSIIYF-RDGVSDGQFDMVLNEELADMENKIPKITVIVAKKRHHTRLFN-GNVLPTVVDTDVVDPTAYDFYLCSHKGEGTSRPTHYYSLLDEFASDDLQKLVYNLCFVFARCTKPVSLATPVYYADLAAYRGRLYYELPP-MH Oryza_sativa_OsAGO4A GQPI-QLLTNHFKVSLFHHYYVLDKLAYDGEKSLFTI-GAL-PVELN-FA-A-KIPMTQEAIRVID-IILRQHSARQSFFHLGGGVRGFHSSFRATQGLSLNIVS-TTMIVKGPVVDFLLARALKNLRIKTSPTEYKIVGLSERNCYESVYEYFFPCINVGK-PKR-PYFPIELCSLVPLQRYTKASSLVEKSRQKPEERVL-KRS-NYEPML-NSCGISIARGFTQVAGRVLQAPGRWN--FNNKRIEKWAVVNFSRDIIKVDGMIDKMK-FLLCVLAE-RKWKRKCLAEFGIITQCV-QYITNVLLKINAKLGGLNSLLKVPTIILGMDVSHGPGQ-SPSIAAVVSVSKYRASVRSQSKLEM--IDGLELLVDFKPDQVIIF-RDGVSESQFTQVLNIELDQIIEACPKFTLIVAQKNHHTKFFQ-NNVPPTVVDNAVCHPRNNDFYMCAHAGMGTTRPTHYHILHDEFSADDLQELVHSLSYVYQRSTTAISVVAPICYAHLAAAQVSQFIKLPR-LH Oryza_sativa_OsAGO4B GQPI-QLLANHYKVSVFFHYNVIDKLAYDGEKSLFTI-GAL-PVELC-FA-A-KIPMSQEALRVLD-IILRQHSARQSFFHLGGGVRGFHSSFRGTQGLSLNIVS-TTMIVKGPVIDFLLARALKNLRIRTTPSEFKIIGLSDRNCNETVYDYFLPCINVGK-PKR-PYFPIELCSLIPLQRYTKASSLVEKSRQKPQERAL-RHS-NYDPML-RASGISIAQNFTQVEGRVLQPPGRWN--FNNKKVDKWAVVNFSRDLIRVDDMFEQIK-FLLCLLPE-RKWKRKCLAEFGIVTQCL-QYLLNLLLKINAKLGGINSLLKTPTIILGMDVSHGPGQ-SPSIAAVVSISKYRASVHTQSKLEM--MSSLESLIDFKPDHVIVF-RDGVSESQFTQVINIELDQIIEACPKFTVIVAQKNHHTKFFP-DNVPPTVVDKQVCHPRNYDFYMCAHAGMGTTRPTHYHVLHDEFSPDDLQELVHSLSYVYQRSTTAISVVAPICYAHLAAAQVGTFLKLPR-LH Oryza_sativa_OsMLE1 GKKV-MIRANHFLVNVLFHYDVLNELAYDGRKSLYTA-GSL-PITIR-IA-G-RTDLPQETIQVLD-VVLRESPSSRSFFSIGEGLRGYYQSLRPTQGLSLNIIS-ATSFFKVTVIQFVEEKALRGVRIETNHRRYKITGITPIPMSQTVVQYFWPCLQSGS-DSR-PYLPMEVCKIVEGQRYSKKTNILRATCQRPQQRMV-LHN-KYDRFA-QEFGIKVCNDLVSVPARVLPPPGQWN--MINKKVDNWTCLSFSGDLIQIENALRDVQ-LLIVILPE--VIKRVCETDLGIVSQCC-QYLENVALKINVKVGGRNTVLEVPTIIFGADVTHPPGE-DSSIAAVVAITKYRGLVSAQPRQEI--IEDLELLIAFRPERIIFY-RDGVSEGQFSHVLLHEMDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDRQICHPTEFDFYLCSHAGIGTSRPTHYHVLYDEFTADALQSLTNNLCYTYARCTRAVSVVPPAYYAHLAAFRARYYVELPK-IK Oryza_sativa_OsPNH1 GARC-VVKANHFLAELLTQYDIMSELAYDGRKNLYTA-GTL-PVAIK-FA-A-RADLPQEALQVLD-IVLRELANGRSFYSLGDGLCGFYQSIRPTQGLSLNIMS-STAFIELPVIEFVAQKALRGVKVEVTHRKYRISGLTTQPTHESVVEYFLPCLQVGN-QKK-AYLPMEACKIVEGQRYTKRTSLLKVTCRRPREQTV-QQN-GYDPYA-KEFGINISEKLTSVEARVLPAPGQWN--MVNKKVNHWACINFSQELAQVEKALKHVE-LLLAILPD--NIKRICETDLGLISQCC-QYLANVSLKINVKMGGRNTVLDIPTIIFGADVTHPTGE-DPSIAAVVAVTKYAGLVCAQARQEL--IQDLELLISFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPSEFDFYLCSHAGIGTSRPAHYHVLWDEFTADEMQTLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRARFYMELPA-VK Oryza_sativa_OsSHL4 GAEI-PLSANHFLVQFIFHYNIKKKLAFDGRKNLYSP-VRF-QVNVR-LV-S-KLCGPQDYLHALD-VVLREGAMGRSLYAIGGGARGFFQRLRPTKGLALNVLS-LSAFHETGIISYLQKKALKNIRVFVCHQRYHVHSLTKETTENMVVDYFLPCLQIGR--SK-PYVPMELCVVCEGQKFLGKSKILKMGCERPSERVV-KGAFHADTYA-DQFSLQVSKHMTKLSGRVLLPPRQWS--FLDSHIKSWALISFGNQLSNLEGKLKKIQ-LLICVMER--RLKRIAETSIGVVTQCC-QFLTNLALKINAKLGGCNIALEEPVMFMGADVTHPPLD-DPSVVAVVAANKYISRMRSQTRKEI--IEQLELLEEFLPSRIIFF-RDGVSETQFYKVLKEEMHAVRTTCPLITFIVVQKRHHTRLFD-QNIPPTVVDTVITHPREFDFYLCSHWGTGTSRPTHYHVLWDEFRSDEVQQLIHNLCYTFARCTRPVSLVPPAYYAHLAAYRGRLYLELPK-LR Pelargonium_hortorum_PhAGO4like GQKI-PLLTNHFKVNVFFHYSVIDRVAYDGEKSLFTV-GPL-PVEIS-FA-A-KIPMSQEALRVLD-IILRQHAARQSFFHLGGGVRGFHSSFRTTQGLSLNVVS-TTMIVQGPVVDFLIARTLKNLRIKTSPTEYKITGLSEKPCKETVYDYFLPCINVGK-PKR-PYFPLELCSLVSLQRYTKAASLVEKSRQKPQERAL-KTS-NYERML-RSSGISISSNFTQVEGRVLQAPGRWN--FNNKKIEKWAVVNFSRDLIKVEKMFEDIQ-FLLCLLPE-RKWKRKNLSEYGIVTQCI-QYLTNVLLKINAKLGGLNSMLKVPTIIVGMDVSHGPGQ-SPSIAAVVSISRYRASVRTQSKVEM--IDSLELLLDFKPDQIIIF-RDGVSESQFNQVLNIELDQIIEACPKFVVIVAQKNHHTKFFP-DNVPPTVIDNKVCHPRNNDFYLCAQAGMGTTRPTHYHVLLDEFSADDLQEFVHSLSYVYQRSTTAISVVAPICYAHLAATQMGQFMKLPR-LQ Phaseolus_vulgaris_PvAGO1 GIKC-IVKANHFFAELLHQYDVMEQLAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPTGRSFYSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVTQKALRGIKVEVTHRKYRISGLTSQATRESVVEYFWPCLQVGN-TQR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPVERTV-YHN-AYDPYA-KEFGIKISEKLAQVEARILPAPGQWN--MMNKKVNNWFCINFSYELAQVEKVLKTRD-LLIVILPD--NLKRICETDLGLVSQCC-QYLANVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAITKYAGLVCAQARQEL--IQDLELLISFKPQRIIFY-RDGVSEGQFYQVLLFELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADALQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Phaseolus_vulgaris_PvAGO10a GTKC-IVKANHFFAELLNQYDIIAELAYDGRKSLYTA-GQL-PVAIK-FV-A-RANLPQEALQILD-IVLRELATGRSFFSLGEGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVVEFVGQKALRGVKVEVTHRKYRVSGLTSQPTRESVVEYFLPCLQVGN-QKK-AYLPMEACKIVEGQRYTKRTALLKVTCQRPRDRTI-QQN-AYDPYA-KEFGIKISEKLASVEARILPAPGQWN--MMNKKVNRWACINFSNELAQVEKALKHVE-LLLAILPD--NLKRICETDLGLISQCC-QYLANVSLKINVKMGGRNTVLDIPTIIFGADVTHPNGE-DPSIAAVVAVTKYAGLVCAQARQEL--IQDLDLLVSFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFIVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRARFYMELPD-LK Phaseolus_vulgaris_PvAGO10b GTKC-LIKANHFLADILSHYNIIAELVYDGGRNLYTS-GLL-PVLIK-FA-T-HVSMPQEALTVFD-IVLRELAAGRFLYSLGGGLRGFYQSIRPTQGLSLNIMS-SMAFIELPVIDFVAQKALRGVKVEVTHRKYRISGLTSQPTRESVVDYFLPCLQVGS-QRK-VYLPMEACKIVEGQRYTKGTSLLKFSCQRPREQTM-QQN-NYNPYA-KEFGISIDNKLASVEARVLPPPGQWN--MMNKKVRYWTCINFSQQLVQVKKALNYVE-LLIVILPD--NLKRICETDLGLISQCC-QYLANVALKINVKMGGRNTVLDIPTIIFGADVTHPSGE-DPSIAAVVAVTKYAGLVCAQPREEL--IQDLELLLSFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPSEFDFYLCSHAGIGTSRPAHYHVLWDEFTADEIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAYRARFYMELPA-LK Phaseolus_vulgaris_PvAGO4 GTKL-RLLTNHFRVNVFFQYSVLDRVAYDGEKTLFTL-GSL-AVEIS-FA-S-KIPLYQEAIRVLD-IILRQHAARQSFFHVGGGVRGFHSSFRTTQGLSLNIVS-TTMIVTGPVVDFLISRTLKNLRIKASPQEYKITGLSDKPCNETVYDYFLPCINVGK-PKR-PYFPLELCSLVSLQRYTKASSLVEKSRQKPQERAL-SRS-NYEPML-RNCGISISSGFTEVEGRVLQAPGRWN--FNQKKIEKWAVVNFSRDLQKVEKMLEFVQ-FLLCLLPE-RKWKKRNLADFGVVTQCI-QYLTNVLLKINAKLGGLNSLLKAPTIIIGMDVSHGPGQ-TPSIAAVVSISKYRACVRTQSKVEM--IDNLELLLDFKPENIIIF-RDGVSESQFNQVLNIELDQIIEACPKFLVIVAQKNHHTKFFP-DNVPPTVIDSKICHPRNYDFYMCAHAGMGTSRPAHYHVLLDEFSADDLQELVHSLSYVYQRSTTAISVVAPICYAHLAATQMGQFMKLPR-LN Phaseolus_vulgaris_PvAGO7 GTVI-SLLANHFLVQFIYHYNIKQNLAYDGRKNLYSP-VEF-QINIK-LV-S-KINGPQDYLHALD-VVLRENPTGRSFYSIGGGARGFFQSLRPTQGLALNVFS-VTAFHEIGVIAYLQKKALKNLRVFVCHQRYRVYGLTEEATENRLVNYFLPCLQISR--SK-PYLPMELCVICEGQKFLGKARILKMGCQRPGERVM-RGNVGPGNQE-KEFKLQVSREMTKLTGRILFPPRQWN--LLDGHIERWALISFGNQLSQLESKLKRIQ-LLICIMER--KLKRIAETSIGVVSQCC-QFLANLALKINAKVGGCTVALDEPVIFMGADVTHPPLD-DPSVAAVVGANKYISRIRSQTRQEI--IQDLELLDDFLPSRIIFF-RDGVSETQFYKVLEDELQSIRCACPSITFAVVQKRHHTRLFY-ENIPPTVVDSVITHPNEFDFYLCSHWGVGTSRPTHYHVLWDEFTSDELQKLVYNLCYTFVRCTKPISLVPPAYYAHLAAYRGRLYLELPK-LS Phaseolus_vulgaris_PvAGO9 GMKI-QLLTNHFKVNVFFHYSIMDRVAYDGEKSLFTI-GSL-PVEIS-YA-A-KIPMFQEGIRVLD-IILRQHAARQSFFHVGGGVRGFHSSFRTTQGLSLNIVS-TTMIITGPVVDFLISRTLKNLRIKTRPQEFKINGLSEFSCQKTVYDYFLPCINVGK-PKR-PYFPIELCELVSLQRYTKAASLVEKSRQKPQERAL-RRS-NYEPLL-RNCGISISTGFTEVEGRVLPAPGRWN--VSNKKVERWAVANFSRDLIRVEKMFETIQ-FLLCLLPD-RKWKKKNLADFGIINQCM-QYLTNVMLKINAKLGGLNSMLKAPTLILGMDVSHGPGQ-TPSIAAVVSISKYRACVRTQSKVEM--IDNLELLLDFKPENIIIF-RDGVSESQFNQVLNIELDRIIEACPKFLVIVAQKNHHTRFFP-DNVPPTVIDNRICHPRNYDFYLCAHAGMGTSRPTHYHVLLDEFSPDQLQELVHSLSYVYQRSTTAISVVAPICYAHLAASQLGHFMKMPP-LK Physcomitrella_patens_PptAGO1 GLRC-IVKANHFFVELLHQYDVMEQLAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTGRSFYSLGDGLRGFYQSIRPTQGLSLNIMS-STAFIEKTVMEFIRDKALRGVKVEVTHRKYRISGLTHQATNESVTDYFLPCLQVGN-SLR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPRDRTV-HHN-AYDPYA-QEFGIRISNELAQVEARVLPAPGQWN--MMNKKVNYWACINFSQELAQSDRALFQLD-LLIAILPD--NLKKQCETVLGVVSQCC-QYLANVALKINVKVGGRNTVLDIPTIIFGADVTHPPGE-DPSIAAVVAVTKYAGLVCAQARQEL--IQDLELLISFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFSADSLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMDLPP-LK Physcomitrella_patens_PptAGO10 GQWC-IVKANHFFAEPLHQYDVMEQLAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEVLQVLD-IVLRELPTGRSFYSLGDGLRGFYQSIRPTQGLSLNIMS-STAFIEKTVMEFIGDKALRGVKVEVTHRKYRISGLTNQATNESVTDYFLPCLQVGN-AQR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPRDRTV-HHN-AYDPYA-QEFGIRISNELAQVEARVLPAPGQWN--MMNKKVNNWACINFSQELAQYDRALIHLD-LLIAILPD--NLKKQCETVLGVVSQCC-QYLANVALKINVKVGGRNTVLDIPTIIFGADVTHPPGE-DPSIAAVVAVTKYAGLVCAQARQEL--IQDLELLISFKPLRIIFY-RDGVSEGQFYQVLLFELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFSADSLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMDLPP-LK Physcomitrella_patens_PptAGO5 GLRC-IVIANHFYAELLHHYDVMEQLAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTGRYFYSLGDGLRGFYQSIRPTQGLSLNIMS-STAFIEKTVIEFVKDKALRGVKVEVTHRKYRISGLTNQATSESVTDYFLPCLQVGN-TQR-PYLPMEVCKIVEGQRYSKRAALLQVTCQRPRDRTV-HHN-AYDPYA-QEFGIRISNELAQVEARILPAPGQWN--MMNKKVQHWACVNFSLELAQSEKALYQLD-LLIAILPD--NLKKQCETVLGVVSQCC-QYLANVALKINVKVGGRNTVLDKPTIIFGADVTHPPGE-DPSIAAVVAVTKYAGLVCAQTRQEL--IADLELLISFKPLRIIFY-RDGVSEGQFSQVLLHELDAIRRACPPVTFVVVQKRHHTRLFS-GNILPTVVDSTICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFSADSLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMDLPP-LK Physcomitrella_patens_PptAGOlike1 GRLT-QLCVNHFKTELVYHYNIMTKLAYDGGKSLFTS-GSL-SVKIE-FA-G-KIRMAIDALRVLD-IVLRESASRDNFFHLGEGVRGYHSSVRPTGGLTLNLMT-MTTMLKILVEEFLMESVLKGVRIETIHRSHKIAGFSPRPIKDLVEQYYLPAIDVGN-KKK-PFLPLELCKIVAGQRYSKSTAQIAACKQGPQERAI-TVS-NYDRII-SEFGLRFENKLASIEGRMLPAPGRWN--FNNKTIDPWAVAVFDDQLVEVEWMLMSLV-FILVILSD--KFKRFCEMKIGIISQCM-QYLGNLALKINLKMGGFNSPLGESTIIFGMDVSHGPGD-LPSIAAVVAVFHYSTQVRTQPKMEM--ITGLELLLTYKPSQIIIY-RDGVSESQFAECLEVEFMAFKRACPGITFIVAQKRHNTRFFN-GNVLPTVVDKDVCHPHNFDFFLVSQAGLGTSRPTHYHVLVNELGPDDIQMLTNNLCYTFGRCSTSISMAAPAAYAHVVAGRYRKLLDLPA-LK Physcomitrella_patens_PptAGOlike2 GRGT-LLGVNYFKTSLVHHYNIMKKLAYDGEKSLFTS-GCL-PVSIE-LA-A-KIRMALDALRVLD-VILREIASRDNFFHLGDGVRGYHSSVRPTLGLMLNLTT-MTVVLKTLVDEFLKEDMLKNVRIETTHRKYRISGFSDRSIRESVYNYFFPALDLGN-SRK-PYMPIELCKIVSGQRYTKPMAQIGASKQAPQERAL-KVC-NYDKLI-AEFGLQFDNKLASVSGRVLPAPGRWN--FNHKTIAAWAVAVFDFQLIEVETMFNALV-FILAILAE--KFKRLCEIRLGIISQCM-QFLGNLALKINLKMGGLNSPLGQSTIIFGMDVTHGPGD-VPSIAAVVAVFHYSTQVKVQPRMEM--IQGLELLMSFKPSQIIIY-RDGVSDSMFAKCLEVEFVAFKRACPGITFIVAKKRHGTRFFN-GNVLPTVVDKDACHPRNFDFFLISQAGLGTARPTHYTILVNELGPDDIQTLTNKLCYTFGRCTSSISMAAPAAYAHILASRYRKLMSVPI-LR Physcomitrella_patens_PptAGOlike3 GRPS-KLCMNHFKTSIVYQYSIMKKLAYDGENCLFTS-GSL-SVKIE-FA-A-TIRMALDALRVLD-IVLRENASRDNFFHLGEGVRGYHSSIKPTGGLTLNLVT-MTTILKITVEKFLAESILKGVKVETTHREHKISGFSDRAIRDSVQQYYLPALVSGN-KKK-AFLPLELCKIIAGQRYTKSQLQIAACKQSPQERAM-EVS-KYDKLI-AEFGLKFESSLAGVTGRILRPPGRWN--FNQKEIDTWAVAIFDESLVDVERMITALV-FILVILPD--KFKRFCEMKIGVVSQCM-QYLGNLALKINLKMGGFNSPLGPSTIIFGMDVSHGPGE-SPSIAAVVAVFHYSTQVRIQPKTEM--IEGLECLKAYKPTQIIVY-RDGISESQFAECLEVEFTAFKRACPGITFIVAQKRHNTRFFN-GNVLPTVVDKDACHPHNYDFFLVSQAGLGTSRPTHYHVLVNELSPDDIQGLTNNLCYTFGRCTTSVSMGKPLQ-------GFRCFLL------ Picea_glauca_PgAGO GRPV-KLLCNHFRVSF-FHYDVMDKVAYDGENSLFTV-GPL-RVEIT-FA-A-KISMAQDALRVLD-IVLRQHASRQSFFHLGGGVRGYHISFRPTQGLSLNMVS-TTMLIKSAVIDFLLAQVLKGVRITTVHMEFKIFGLSEKPCKETVHDYFLPCLDVGR-KKR-PYLPIELCKILPGQRYTKAT?LVEQSRQKPDERAM-DVN-NYDPLL-KACNINVDKQLVRLDGRVLDPPGRWN--FNNKTIGDWAIACFNRELQQVERMLSQMQ-FLLCILPE-RKWKRKFLADLGVINQCI-QYLTNVALKINAKVGGLNSVLTKPTIIIGMDVSHGPGH-APSISAVVSISRYRASVRTQSKVEM--IEALELLVDFKPQQMIVF-RDGVSESQFDQVLNVELQAIYKACPKVTLIIAQKNHHTKLFP-GNVQPTIVDAQICHPRNFDFYLCPQAGPGTSRPTHYHVLLDEFSVDDLQILVHALSYVYQRSTTAISSVAPINYAHLAASQMQQFLKLPV-LH Pisum_sativum_PsAGO1 GKKC-VVKANHFFAELLHQYDVMEQLAYMAAKA-FIS-GP--SVINL-LP-G-LP--PQEALQVLD-IVLRELPTGRSFYSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVTQKALRGIKVEVTHRKYRISGLTSQATRESVVEYFWPCLQVGN-TQR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPLDRTV-HHN-AYDPYA-KEFGIKISEKLAQVEARILPAPGQWN--MMNKKVNNWFCVNFSDELAHVEKVLKTRD-LLIVILPD--NLKRICETDLGVVSQCC-QYLANVSLKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAITKYAGLVCAQARQEL--IQDLELLISFKPQRIIFY-RDGVSEGQFYQVLLFELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADALQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Pisum_sativum_PsAGO2 GKKC-VVKANHFFAELLHQYDVMAQLAYDGRKSLYTA-GPL-PVVIK-FA-S-RADLPQEALQGLD-IVLRELPTGRSFYSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIEFVAKKALRGIKVEVTHRRYRISGLTSQTTRESVVEYFWPCLQVGN-PQR-PYLPMEVCKIVEGQRYSRRTALLKVTCQRPPDRTV-RHN-AYDPYA-KEFGIKISDKLA----------GQW-----NKKVNNWFCVNFSCELANVEKVLRRRD-LLIVILPD--NLKRICETDLGVVSQCC-QYLANVSLKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAITKYAGLVCAQARQEL--IQDLELLISFKPQRIIFY-RDGVSEGQFYQVLLFELDAIRKACPTVTFVVVQKRHHTRLFS-GNILPTVVDSNICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFSADELQSLSNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPE-LK Populus_trichocarpa_PtAGO1 GIRC-IVKANHFFAELLHQYDVMEQLAYDGRKSLYTA-GAL-PVTIK-LA-A-RADLPQEALQVLD-IVLRELPTGRSFYSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVTQKALRGVKVEVTHRKYRISGLTSQATRESVVEYFWPCLQVGN-QQR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPQERTV-YHN-AYDPYA-KEFGIKISDKLASVEARILPPPGQWN--MMNKKVNNWICVNFSYELAQVERVLKNRD-LLIVILPD--NLKRICETDLGLVSQCC-QYLANVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAVTKYAGLVCAQARQEL--IQDLELLISFKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Populus_trichocarpa_PtAGO10 GTKC-IVKANHFLAELLNQYDIMAELAYDGRKSLYTA-GEL-PVVIK-FV-A-RANMPQEALQILD-IVLRELSSGRSFFSLGDGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIEFVAQKGLRGVKVEVTHRKYRVSGLTSQPTRESVVEYFLPCLQVGN-QKK-AYLPMEACKIVEGQRYTKRTALLRVTCQRPRDRTV-QHN-AYDPYA-KEFGIKISEKLASVEARILPAPGQWN--MMNKKVSRWACINFSNELAQVEKALKHVE-LLLAILPD--NLKRICETDLGLITQCC-QYLANLSLKINVKMGGRNTVLDIPTIIFGADVTHPNGE-DPSIAAVVAVTKYAGLVCAQARQEL--IQDLDLLISFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFIVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRARFYTELPA-LK Populus_trichocarpa_PtAGO4a GQRI-QLLTNHFKVAVFYQYSVMDKVAYDGEKTLFTT-GSL-PVQIS-YA-T-KIPVFQEAVRVLD-IVLRQNAARQSFFHLGGGVRGFHSSFRAAQGLSLNIVS-TTMIVKGPVVDFLIMRMLKNLRIKTNHTEYKITGLTEKSCRETVYDYFFPCINVGK-PKR-PYFPLELCNLVSLQRYTKAASLVEKSRQKPQERAL-RSS-NYDPML-RSSGISISAQFTQVEGRVLSAPGRWN--FNNKKIEKWAIVNFSNNLIKVERMFEAIQ-FLLCILPE-RKWKRKNLSDLGIVTQCI-QYLTNVLLKINAKLGGMNSLLKLPTLILGMDVSHGPGH-SPSIAAVVSISRYRASVRTQSKVEM--IANLESLLDFKPDQIIIF-RDGVSESQFIQVLNIELEQIIEACPKFMVIVAQKNHHTKFFP-DNVPPTVIDNKVCHPRNNDFYMCAHAGMGTTRPTHYHVLHDEFSADDLQELVHSLSYVYQRSTTAISVVAPICYAHLAASQMTQFIKLPR-LH Populus_trichocarpa_PtAGO4b GQKI-QLLSNHFKVSIFFHYCLIDKVAYDGEKSLFTI-GAL-PVEMS-FA-A-KIPMSQEALRVLD-IILRQHAARQSFFHLGGGVRGFHSSFRTSQGLSLNIGS-TTTIIQGPLIDFLIARTLKNLRIRVSPQEYRITGLSENTCKETVYHYFLPCINVGK-PKR-PYIPVELCSLLPLQRYIKASQLVEKSRQKPQEKVM-KSN-NYEQML-RSCGITISSQFTQVQGRVLTAPGRWN--FNHKKIENWAVVNFSRDLIRVEKMFEQIR-FLVCLLPD-RKWKRKNLAEYGIFNQCL-QYILNVLLKINAKLGGLNSLLKVPTIIFGMDVSHGPGQ-SPSIAAVVSLSRYRASVRSQSKVEM--VDSLELLLDYKPAQIIIF-RDGVSESQFNQVLNIELDQIIEACPKFTVIVAQKNHHTKFFP-DNVPPTVIDNAVCHPQSYDFYMCAHAGMGTTRPTHYHVLLDEFSADDLQELIHSLSYVYQRSTTAISVVAPVRYAHLAATQISQFLKLPE-LH Populus_trichocarpa_PtAGO6 GRHI-SLLTNHFKVSVFYQYNLIDRLAYDGEKSLYTV-GPL-PVETS-YA-A-KIPLTQDALRVLD-IILRQQAARQSFFHVGGGVKGFHSSFRTTQGLSLNMVS-TTMILTGPVIDFLIVRMLKNLRVKTKHMEFKIIGLSEKPCNQTVYDYFLPCLDVGK-PKR-PYLPLELCSLISLQRYKKAASLVEKSRQKPQERAM-RSY-CYDPVL-SSCGISIEKQMTQVDGRILETPVRWN--FNNKTISKWAIVNFSRELINVERMFELIE-FILCVLAE-RKWKKTSLSDFGIVTQCI-QYLTNVLLKINSKLGGINSLLDTPTMILGMDVSHGPGR-SPSVAAVVGISRYRASVRTQSKVEM--IDALELLVDFKPKQIIVF-RDGVSESQFNQVLNIELEQIIKAYPKFTVIVAQKNHHTKLFT-ENVPPTVVDTKIVHPRNYDFYMCAHAGMGTSRPAHYHVLLDEFSPDELLNLVHSLSYVYQRSTTAVSIVAPICYAHLAAAQIGQFMKLPR-LH Populus_trichocarpa_PtAGO7 GSVI-TLLANHFPVQFIFHYNIKQKLAYDGRKSLYSP-VEF-QINIK-LV-S-KLDGPQDYLHALD-VVLRESPMGRSLYSIGGGARGFFQSLRPTQGLALNVFS-VTAFHEIGVIPYLQKKALKNIRIFVCHQRYRVFGLTEEATENRLLNYFLPCLQISR--SK-PYLPMELCMICEGQKFLGKARILKMGCQRPKERVM-RGSVGPGSQG-REFKLHISREMTRLSGRILQPPCQWN--LLDSHIQRWALISFGNQLSQLESKLKKIQ-LLICVMEK--KLKRIAETSVGVVTQCC-QFLANLALKINAKVGGCTVALNEPVIFMGADVTHPPLD-DPSVAAVVGANKYVSRMRSQTRQEI--IQDLELLDDFLPKRIIFF-RDGVSETQFYKVLKEELQAIREACPPITFAVVQKRHHTRLFD-ENIPPTVVDTVITHPREFDFYLCSHWGVGTSRPTHYHVLWDEFTSDELQKLVYNLCYTFVRCTKPVSLVPPAYYAHLAAYRGRLYLELPK-LS Populus_trichocarpa_PtAGOlike1 GSRC-LIRANHFLVELLHHYDIMRELAYDGRKGFYTA-GPL-TVTIR-LA-S-KTDLPHDTIQVLD-VVLREPPSGRSFFTIGNGIKGFYQSLRPTQGMSLNIVS-VAAFYEILAVDFVAKKALRGVRVKVTHKRYKITGISASATNQSVVQYFWPALQSGN-DSR-PFLPMECCKIIEGQRYSKKTALLREACRRPVERIV-HFN-DVDDLA-KEFGVSVKKELTCIDARVLPPPGQWN--MINAKVNFWMCVNFSRALVGLEKTLAEVQ-ILIIILPD--VIKRVCETELGIVSQCC-QYLENVALKINVKAGGRNTVLDTPTIIFGADVTHPPGE-DPSIAAIVAVTTYRGLVSAQKRQEI--IQDCELMIAFKPSRIIFY-RDGVSEGQFSQVLLYEMDAIRKACPPVTFIVVQKRHHTRLFS-GNILPTVVDTKICHPSEHDFYLCSHAGIGTSRPVHYHVLCDMFTADCLQMLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRARYYIELPA-IS Populus_trichocarpa_PtAGOlike2 GRKC-TIRANHFVVEVLFHYDVISQLAYDGRKSLYTA-GAL-PVAIK-YA-S-KVDMPQETIQILD-IVLRASPSGRSFFSLGNGIRGYYQSLRPTQGLSLNIVS-ARSFYEILVTEFVAKRALRGIKVEISYRSFKVTGISNLPVDKSVHQYFLPPLQAGT-DAK-PYLPMELCKIAGGQRYTKKTALLRATCQRPSARAN-NLS-STNVLVRNEFGIQVKEELTSVDARVLPPPGQWN--MINKKIDFWTCVNFSWQLMDIEKALHDVQ-LLIIILPD--FIKRICETELGIVSQCC-QYLENVALKINVKAGGRNTVLDLPTIIFGADVTHPPGE-DPSIAAVVAVTKYRGLVSAQAREEI--IQDLELFIAFKPHRIIFY-RDGVSEGQFSQVLLHEMQAIREACPPVTFVVVQKRHHTRFFS-GNILPTVVDTKICHPTEFDFYLNSHAGIGTSRPTHYHVLFDEFTADGLQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARYYIELPV-VK Populus_trichocarpa_PtAGOlike3 GKKC-VIRANHFVVEVLFHYDVISQLAYDGRKSLYTA-GAL-PVAIK-YA-S-KVDMPQETIQILD-IVLRASPSGRSFFSLGDGIRGYYQSLRPTQGLSFNIVS-ARSFYEILVTEFVAKRALRGIKVQITYKSYKVTGISNLPVNKSVYQYFLPPLQAGT-DAK-PYLPMELCQIAGGQRYTKKTALLRATCQRPSARMV-RQN-DYNALVRDEFGIQVKEELTLVDARVLPPPGQWN--MIDKKIDFWTCLNFSWQLMDIEKALHDVQ-LLIIILPD--VIKRVCETELGIVSQCC-QYMENVALKINVKAGGRNTVLDVPTIVFGADVTHPAGE-DPSIAAVVAVTKYRGLVSAQAREEI--IEDLELLIAFKPFRIIFY-RDGVSEGQFSQVLLHEMQAIRQACPRVTFVVVQKRHHTRFFS-GNILPTVVDTTICHPTEFDFYLNSHAGIGTSRPTHYHVLFDEFSSDGLQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARYYIELPV-IK Prunus_persica_PprAGO10 GIKC-IVKANHFFAELLNHYDIMAELAYDGRKSLYTA-GEL-PVVIK-FV-A-RANMPQEALQILD-IVLRELSNGRSFFSLGEGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIEFVAQKALRGVKVEVTHRKYRVSGLTSQPTRESVIEYFLPCLQVGN-QKK-AYLPMEACKIVEGQRYTKRTALLKVTCQRPRDRTV-QHN-AYDPYA-KEFGIKISEKLASVEARILPAPGQWN--MMNKKVSRWACINFSNELAQVEKALKHVE-LLLAILPD--NIKRICETDLGLISQCC-QYLANVSLKINVKMGGRNTVLDIPTIIFGADVTHPNGE-DPSIAAVVAVTKYAGLVCAQARQEL--IQDLDLLVSFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFIVVQKRHHTRLFS-GNILPTVVDTKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRARFYMELPA-LK Prunus_persica_PprAGO1a GIRC-TVKANHFFAELLHQYDVMEQLAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTGRSFYALGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIEFVTQKALRGVKVEVTHRKYRISGLTSQATRESVVEYFWPCLQVGN-QQR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPHDRTV-RHN-AYDPYA-KEFGIKISENLAQVEARILPPPGQWN--MMNKKVNNWICINFSSELAQVEKVLKTRD-LLVVILPD--NLKRICETDLGLVSQCC-QYLANVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAITKYAGLVCAQARQEL--IQDLELLISFKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADALQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Prunus_persica_PprAGO1b GIKC-IVKANHFFAELLHQYDVMKRLAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTGRSFYSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIEFVNEKALRGIKVEVTHRKYRISGLTSQATRESVVEYFLPCLQVGN-QQR-SYLPMEVCKIVEGQRYSRRTALLKVTCQRPHERTV-RQN-AYDPYA-QEFGIKISENLTLVEARILPAPGQWN--MMNKKVNNWMCINFSHELAQVERALKTRE-LLIAILPD--NLKRICETDLGLVSQCCQQYLANVTLKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAVTKYAGLVSAQARQEL--IQDLELLISFKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFSADGLQTLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRARFYLELPA-LK Prunus_persica_PprAGO4a GTKI-PLVTNHFKVNVFFHYSIIDRVAYDGEKSLFTV-GSL-PVEIS-YA-A-KIPMSQEALRVLD-IILRQHASRQSFFHVGGGVRGFHSSFRTTQGLSLNIVS-TTMIIQGPVVDFLIARTLKNLRVKTSPLEYKITGLSEKPCRETVYDYFLPCINVGK-PKR-PYIPLELCSLVSLQRYTKAASLVEKSRQKPQERAL-KIN-NYEPML-RSCGVSISSGFTQVEGRVLPAPGRWN--FNNKKIEKWAVVNFSRDLIKVERMFEDIQ-FLLCLLPE-RKWKRKNLAEYGIVTQCI-QYLTNVLLKINAKLGGLNSLLKAPTIILGMDVSHGPGQ-SPSIAAVVSISRYRASVRTQSKVEM--IDSLELLLDFKPDQIIIF-RDGVSESQFNQVLNIELDQIIEACPKFVVIIAQKNHHTKFFP-DNVPPTIIDNKVCHPRNNDFYLCAQAGMGTTRPTHYHVLLDEFSADDLQELVHSLSYVYQRSTTAISVVAPVCYAHLAATQMGQFMKLPR-LK Prunus_persica_PprAGO4b GQRI-PLLTNHFKVAVFFHYSVLDKVAYDGEKSLFTV-GPL-PVQVN-FA-T-KIPMFQEAVRVLD-IILRQNAARQSFFHLGAGVRGFHSSFRATQGLSLNMVS-TTMIVKGPVLNFLMERMLKNLRITTYSMEYKITGLSDKPCKETVSNYFFPCINVGK-PKS-PYFPLELCNLVSLQRYTKAASLVEKSRQKPQERAL-KTS-KYDLML-RSSGISIGADFVQVEGRVLSAPGRWN--FNNKKIERWAICNFSNNMLKVDKMIEYIQ-LLLCILPE-RKWKRRNLSELGIVTQCI-QYITNVLLKINAKLGGMNSLLKCPTLILGMDVSHGPGR-SPSIAAVVSISRYRAAVRTQSKVEM--IASLELLLDFKPDQIIIF-RDGVSESQFNQVLNLELDQIIQACPKFMVIVAQKNHHTKFFT-ENVPATIIDNKVCHPKNNDFYLCSHAGMGTTRPTHYHVLYDEFSADDLQELVHSLSYVYQRSTTAISVVAPICYAHLAAAQISQFIKLPR-LH Prunus_persica_PprAGO5 GTRI-QVRANHFLVEVLHHYDVIKQLAYDGMKSIYTA-GPL-PVAVK-LA-N-KPDLPQEAIQVLD-VVLRAAPSGRSFFALGDGLRGFYQSLRPTQGLSLNIVS-ARSFYEILVTEFVKKKALKGVKVALAYRSYRITGVSTEPLSQSVVQYYMPALQAGS-DSN-PYLPMELCSIVAGQRYSRKTALLRATCQRPHERMV-KQS-NFDQLIKDEFGMQVREDMALVDARVLPPPGQWN--MINKKVDFWAFVNFSEDLVNIEKVLIDIQ-LLIIILPD--VVKRICETELGIVSQCC-QYLENLALKINVKVGGRNTVLDIPTIIIGADVTHPPGE-DPSIAAVVAVSKYRGIVSAQAREEI--IQDLEHFRAFKPERIIFY-RDGVSEGQFSQVLLYEMDAIRKACPPVTFVVVQKRHHTRLFS-GNIQPTVVDTKICHPTEFDFFLNSHAGIGTSRPAHYHVLFDEFTADQLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARYYIELPQ-IK Prunus_persica_PprAGO7 GTVI-SLLANHFLVQFIFHYNIKQTLAYDGRKNLYSP-VEF-KINIK-LV-S-KIDGPQDYLHALD-VVLREAPLGRSLYSIGGGARGFFQSLRPTQGLALNVFS-VTAFHEVGVISYLQKRALKNIRVFVCHQRYRVFGLTEEATENRLVTYFLPCLQISR--SK-PYLPMELCMICEGQKFLGKARILKMGCQRPKERVM-RGPVGPGIQE-REFKLHVSREMTRLKGRVLQPPRQWN--LLGSHIERWALISFGHQLSQLESKLKRIQ-LLICVMER--KLKRIADTSVGVLSQCC-QFLANLALKINAKVGGCTVSLDEPVIFMGADVTHPPLD-DPSVAAVVGANKYVSRMRSQTRQEI--IQDLELLDEFLPKRIVFF-RDGVSETQFYKVLQEELQAIKGACPPITFAVVQKRHHTRLFD-ENIPPTVVDTVITHPKEFDFYLCSHWGVGTSRPTHYHILWDEFTSDELQKLVNILCYTYVRCTKPVSLVPPAYYAHLAAYRGRLYLELPK-LS Ricinus_communis_RcAGO1 GIRC-IVKANHFFAELLHQYDVMEQLAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPTGRSFYSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVNQKALRGVKVEVTHRKYRISGLTSQATRESVVEYFWPCLQVGN-QQR-PYLPMEVCKVVEGQRYSKRTALLKVTCQRPQERTV-HHN-AYDPYA-KEFGIKISEKLASVEARILPAPGQWN--MMNKKVNNWICINFSYELAQVEKVLKTRD-LLIVILPD--NLKRICETDLGLVSQCC-QYLANVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAVTKYAGLVCAQARQEL--IQDLELLISFKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Ricinus_communis_RcAGO10a GTKC-IVKANHFFAELLNQYDIMAELAYDGRKSLYTS-GEL-PVVIK-FV-A-RANMPQEALQILD-IVLRELSTGRSFFSLGDGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIELVAQKALRGVKVEVTHRKYRVSGLTSQPTRESVVEYFLPCLQVGN-QKK-AYLPMEACKIVEGQRYTKRTALLKVTCQRPRDRTV-QHN-AYDPYA-KEFGIKISEKLASVEARILPAPGQWN--MMNKKVSRWACINFSSELAQVEKALKHVE-LLLAILPD--NLKRICETDLGLISQCC-QYLANVSLKINVKMGGRNTVLDIPTIIFGADVTHPNGE-DPSIAAVVAVTKYAGLVCAQARQEL--IQDLDLLVSFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFIVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRARFYMELPA-LK Ricinus_communis_RcAGO10b GTKC-IVKANHFLAQMLSHYSIMTQLVYDGGRNLYTA-RSL-PVTIK-FE-A-LAGMPQEAITVID-IVLRELAAGRSFYSLEGGLRGFYQSIRPTQGLSLNIMS-ATAFIELLVIEFVAQKALRGVKVEVTHRKYRISGLTTQPTRESVVEYFLPCLQVGN-QRK-VYLPMEACKIVRGQRYTKGTSLLKVSCQRPRDQTI-HQN-GYDPYA-KEFGISIDSKLASIDARVLPAPGQWN--MMNKKVRYWACINFSQQLVQVKKALKYVE-LLIAILPD--SLKRICETDLGLISQCC-QYLANVSLKINVKMGGRNTVLDIPTIIFGADVTHPSGE-DPSIAAVVAVTKYAGLVCAQPRQEL--IQDLELLLSFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVIVQKRHHTRLFS-GNILPTVVDTKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADEIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAYRARFYMELPA-LK Ricinus_communis_RcAGO4a GQKI-SLLTNHFKVNVFFHYCVIDRVAYDGEKSLFTV-GAL-PVEIS-FA-A-KIPMSQEAIRVLD-IILRQHAARQNFFHVGGGVRGFHSSFRTTQGLSLNIVS-TTMIIQGPVVDFLIARTLKNLRIKASPQEYKITGLSEMPCKETVYDYFLPCINVGK-PKR-PFIPIELCSLVSLQRYTKAASLVEKSRQKPQERAL-KSS-NYEPML-RSCGVSISTSFVQVDGRQLQAPGRWN--FNNKKIERWAVVNFSRDLTKVEKMFDSIK-FLLCLLPE-RKWKKKNLSDFGIVTQCI-QYLTNVLLKINAKLGGLNSMLKVPTIIIGMDVSHGPGH-SPSIAAVVSISRYRACVRTQSKVEM--IDSLELLLDFKPEQIIIF-RDGVSESQFNQVLNIELNQIIEACPKFVVIIAQKNHHTKFFP-DNVPPTVIDNKVCHPRNNDFYLCAHAGMGTTRPTHYHVLLDEFSADELQELVHSLSYVYQRSTTAISVVAPVCYAHLAATQMGQFMKMPK-LS Ricinus_communis_RcAGO4b GQRI-ELLTNHFKVGVFSHYSVIDKVAYDGEKSLFTV-GSL-PVEIS-FA-A-KIPMSQEAIRVLD-IVLRQHAARQSFFHLDGGVRGFHSSFRVSQGLSLNIGS-TTTIIQGPLIDFLLARTLKNLRIRVSPQEYRITGLSENLCKDTVYEYFLPCINVGR-PKR-PFFPIELCSLLPLQRYTKASKLVESSRQKPQEKVM-KSN-NYDPIL-RSCGITISSQFTQLEGRVLTAPARWT--FNNKKIENWAVVNFSRDLCRVEKMFEQIR-FLLSIFPD-RKWKRKNLAEFGIFNQCL-MYVTNVLMKINAKLGGLNTFLKVPTIIFGMDVSHGPGQ-SPSIAAVVSLSRYRASVHSQSKVEM--IDSLELLLDFKPAQIIIF-RDGVSESQFNQVLNIELNQIIEACPKFTVIVAQKNHHTKFFA-ENVPPTVVDNGVCHPQSNDFYMCAHAGMGTTRPTHYHVLLDEFSADDLQELIHSLSYVYQRSTSAVSVVAPVRYAHLAATQIRLFMKLPV-LH Ricinus_communis_RcAGO5 GMKC-VVKANHFLVDVLRQYDVISQLAYDGRKSLYTA-GPL-PVAIK-FA-S-KPDIPQETIQVLD-IVLRETPSGRSFFSLGDGIRGYYQSLRPTQGLSLNIVS-ARSFYEIIVTDFVSKKALKSVKVQILHKSYKVTGISNKPLNQSVVQYFLPALQAGS-DAK-PYLPMELCKIVDGQRYSKKTALLRATCQRPHERMV-KRN-SYDVLVRDEFGIQVKEELTFVDARVLPAPGQWN--MINKKVNFWTCVNFSRQLIQIGKTLNDIQ-LLIIILPD--IIKRVCETELGIVSQCC-QYFENVALKINVKVGGRNTVLDCPTIIFGADVTHPPGE-DPSIAAVVAVTKYRGIVSAQAREEI--IQDLELFVAFKPKRIIFY-RDGVSEGQFSQVLLYEMDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVIDTKICHQREFDFYLNSHAGIGTSRPTHYHVLYDEFTADNLQVLTNNLCYTFARCTRSVSIVPPAYYAHLAAFRARYYIELPV-IK Ricinus_communis_RcAGO6 GHRI-PLLSNHFKVSIFYQYSLIERLAYDGEKTLYTV-GPL-PVAIS-YA-A-KIPLTQDALRVLD-IILRQQAA----------------------------VS-TTMILTGPVIDFLLARMLKNLRIKPRHMEFKIRGLSEKPCNQTVYEYFLPCLDVGK-PKR-PYLPIELCSLVSLQRYTKAASLVEKSRQKPLDRAV-RNY-RYNPML-SVCGISIEKQLTQVEGRVLETPGRWN--FNNKTIERWALVNFSRDLVNVEKMFEQIQ-FILCVLPE-RKWKKKCLSDFGIVTQCI-QYLTNVLLKINSKLGGINSLLDTPTMILGMDVSHGRGC-SPSVAAVVGISRYRACVRTQSKVEM--IDALELLVDFKPKQIILF-RDGVSESQFNQVLNIEVEQIKQAYPKFTVIIAQKNHHTKLFP-ENVPATVVDTKIVHPRNYDFYMCAHAGMGTSRPAHYIVLLNEFSPDDLQNLIHSLSYVYQRSTTAISIVAPVCYAHLAAQQMGQFMKLPR-LH Ricinus_communis_RcAGO7 GPVI-TLLANHFLVQFIFHYNIKQKLAYDGRKNLYSP-VEF-QLNIK-LV-S-KLDGPQDYLHALD-VVLRESPMGRSFYSIGGGARGFFQSLRPTQGLALNVFS-VTAFHEIGVIAYLQKKALKNIRVFVCHQRYRVYGLTEQATENRLLSYFLPCLQISR--SK-PYLPMELCMICEGQKFLGKARILKMGCQRPKERVM-RGSVGPGNKD-REFKLHVSREMTKLKGRILQPPRQWN--LLDSHIERWALMSFGNQLSQLESKLKKIQ-LLICIMEK--RLKRIAETSVGVVSQCC-QFLANLALKINAKVGGCTVALDDPVIFMGADVTHPPLD-DPSVAAVVGANKYASRMRSQTRQEI--IQDLELLDDFLPKRIIFF-RDGVSETQFHKVLQEELQAIREACPPITFAVVQKRHHTRLFD-ENIPPTVVDTVITHPKEFDFYLCSHWGVGTSRPTHYHVLWDEFTSDELQKLVYNLCYTFVRCTKPVSLVPPAYYAHLAAYRGRLYLELPK-LS Sarcophilus_harrissi_ShAGO2 GRTI-KLQANFFEMDIIYHYEIVEHMVFDGRKNLYTA-MPL-PVAIK-WM-S-CVSLPFETIQALD-VVMRHLPSGRSFFTLGGGRFGFHQSVRPSLKMMLNIVS-ATAFYKQPVIEFVCEKEIKGLKVEITHRKYRVCNVTRRPASHTVAQYFLPCLQVGQ-EQK-HYLPLEVCNIVAGQRCIKKSTMIRATARSAPDRLM-RSA-SFDPYV-REFGIMVKDEMTDVTGRVLQPPGVWD--MRNKQIKVWAIACFAEQLRKVEPMFRHLQ-LVVVILPG--KVKRVGDTVLGMATQCV-QTLSNLCLKINVKLGGVNNILQQPVIFLGADVTHPAGD-GPSIAAVVGPNRYCATVRVQQRQEI--IQDLELLIQFKPTRIIFY-RDGVSEGQFQQVLHHELLAIREACPGITFIVVQKRHHTRLFS-GNIPATTVDTKITHPSEFDFYLCSHAGIGTSRPSHYHVLWDDFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVAVQ-VH Selaginella_moellendorfii_SmAGO10 GVKC-IVKVNHFFAELLHHYDVMEQLVYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTGRSFYSLGDGLRGFYQSIRPTQGLSLNIMS-STAFIELPVVDFVGKKALRGVKVEVTHRKYRISGLTSQPTQESVMEYFLPCLQVGN-QER-PYLPMEVCKIVEGQRYTKRTALLKVTCQRPRERTV-YHN-AYDPYA-QEFGIRISDRLALVEARILPAPGTWN--MMNKKVNYWACVNFSNDLAQVERALKSVE-LLIAILPD--NLKRICETDLGLVSQCC-QYLANVALKINVKVGGRNTVLDTPTIIFGADVTHPPGE-DPSIAAVVAVTKYAGLVCAQARQEL--IQDLELLISFKPGRIIFY-RDGVSEGQFYQVLLHELDAIRKACPLVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGLQSLTNSLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Selaginella_moellendorfii_SmAGO1a GVKC-IVKVNHFLAELLHHYDVMEQLVYDGRKSLYTA-GPL-P--------------PQEALQVLD-IVLRELPTGRSFYSL---------------------MS-STAFIELPVVDFVGKKALRGVKVEVTHRKYRISGLTSQPTQESVMEYFLPCLQVGN-QER-PYLPMEVCKIVEGQRYTKRTALLKVTCQRPRERTV-YHN-AYDPYA-QEFGMRISDRLALVEARILPAPGTWN--MMNKKVNYWACVNFSNDLAQVERALKSVE-LLIAILPD--NLKRICETDLGLVSQCC-QYLANVALKINVKVGGRNTVLDTPTIIFGADVTHPPGE-DPSIAAVVAVTKYAGLVCAQARQEL--IQDLELLISFKPGRIIFY-RDGVSEGQFYQVLLHELDAIRKACPLVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGLQSLTNSLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Selaginella_moellendorfii_SmAGO1b GSKC-VVKANHFFAELLHQYDVMELLAYDGRKSLYTA-GPL-PIVIK-FA-A-RADLPQEALQVLD-I-WSPISHDDHFIPSGMAWAGFTKVSGRRRSLDLLTMS-STAFIELPVVDFVGQKALRGVKVEVTHRKYRISGLTSQPTQESVVEYFLPCLAVGN-QQR-PYLPMEVCKIVEGQRYSKRNNLLKVTCQRPKDRTV-RHN-AYDPYA-QEFGIRISDKLASVEARILPAPGQWN--MMNKKVNYWACINFSAELALVERALKMLE-LLIAILPD--SLKRICETDLGLISQCC-QYLANVALKINVKVGGRNTVLDIPTIIFGADVTHPPGE-DPSIAAVVAVTKYAGLVCAQARQEL--IQDLELLLAFKPLRIIFY-RQRWSER-------------RPACPPVTFVVVQKRHHTRLFS-GNILPTVVDTKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPP-VK Solanum_lycopersicum_SlAGO4a ---------------------VLDTVAYDGEKSLFTI-GAL-PVEIS-FA-A-KIPMSQEALRVLD-IILRQHAARQSFFHVGAGVRGFHSSFRTTQGLSLNIVS-TTMIIQGPVVDFLIARVLKNLRVKTTPQEYKITGLSDRPCRETVFDYFLPCINVGK-PKR-PFFPIELCSLVSLQRYTKSSSLVEKSRQKPQERAL-KIN-QYEPLL-RSCGISISNNFTQIEGRVLPPPGRWN--FNNKRIERWAVVNFSSDLIKVEKMFEQVK-FLLCLLPE-RKWKRKNLAEYGIVTQCI-QYITNVLLKINAKLGGLNSMLKVPTIILGMDVSHGPGQ-SPSIAAVVSISRYRASVRTQSKVEM--IDNL---------------RDGVSESQFSQVLNVELDQIIEACPKFVVIVAQKNHHTKFFP-NNVPPTIIDNKVCHPRNYDFYLCAHAGMGTTRPTHYHVLYDEFSADDLQELVHNLSYVYQRSTTAISVVAPICYAHLAATQMGQWMKLPK-LE Solanum_lycopersicum_SlAGO4b GRNI-QILTNHFQVNVFFHYSVLDRVAYDGEKSLFTI-GSL-PVKIS-LA-G-KIPMSQEALRVLD-IILRQHAARQSFFHVGGGVRGFHSSFRTTQGLSLNIMS-TTMIIKGPVLDFLIARVLKNLKVQTATQEFKITGLSEKSCRETVYDYFLPCLNVGK-PKR-PYFPIELCTLVSLQRYTKAASLVEKSRQKPQERAL-KMN-NYEPLL-HSCGVTINSDFTQIEGRVLSAPGRWN--FNNKRVEKWAVVNFSECLTGVDKMFEEIK-FLLCLLPE-RKWKRKNLADHGIVTQCL-QYLTNLLLKINAKLGGLNSMLKVPTMILGMDVSHGPGQ-SPSIAAVVSISHYRASVRTQSKVEI--IDNIELLLDFKPQQILVF-RDGVSESQFNQVLNIELDQIIEACPKFVIIVAQKNHHTKFFA-NNVPPTIIDNKVCHPRNNDFYLCAHGGMGTTRPTHYHVLLDEFKPDELQELVHNLCYVYQRSTTATSIVAPIGYAHLAAAQVGQWMKLPR-LQ Solanum_lycopersicum_SlAGOlike1 VKSI-ALLANHFPVRFIMHYDIREKLAYDGKKNIFSA-VQL-PITIK-LV-A-ELKLPRDILQGME-LVMKENPTGRCFYSFRFGVRGFQQSLKPTKGLALCLYS-VLALRKMPVLDFLKEGALVGLKVRVIHQKFLIKQLTDCKTRELLVDYFFPSLDIGK-GNK-KYVPMEFCVLVEGQRYPKELFLKNISLARPQDRMV-RAGDGPGAVT-RNFDIGVDRNMTRVPGRILPPPCQWN--LVGKSLQRWALIDFSFRLKDVHKLLDGVQ-MIVCVMTS--KLKWVSETQIGVVTQCC-QYLANLCMKINAKLGGSNMELEDNVMFIGADVNHPAKN-VPSIAAVVAANRYAARVCPQVRTEK--ILEFDLVHTYKPNKIVVF-RDGVSEGQFDMVLNEELLDLAKAIPAITLVVAQKRHHTRLFP-ANVPPTVVDTIIVHPSDFDFYLCSHFGGGTSKPTHYHVLWDDFNSDSLQKLIYNMCFTFARCTKPVSLVPPVYYADLVAYRGRMFQEFYD-LH Solanum_lycopersicum_SlAGOlike2 VKQI-ELLANHFVVAFIMHYD--------------NA-VQL-PITIN-LV-A-ELQLPRDILQGMD-LFMKDNPSGRCFYSFRFGAKGFQQSLKPTEGLALCLYS-VLALRKMSVLNYLRNDALKGLKVTVNHQKFVIKKLTDRKTSELLVEYFFPSLDVGK-GSK-IYVPMEFCVLVEGQRFPKEMFLKNMSLAQPNERMV-KAEDGPGAIT-DNFGIKVDKNMTGVVGRVLPPPCQWN--LVGKSLQRWALIDFSIGLRDVEKLLNFVQ-MIVCVMTS--KLKWVSETKIGVVTQCC-QYLANLCMKINAKLGGSNMELGDNVMFIGADVNHPSRD-APSIAAVVAANRYAARVCPQKRTEK--ILEFDLVRTYKPNKIVVF-RDGVSGSQFDMVLNEELNDLVKDIPEITLVVAQKRHHTRLFE-GNVPPTVVDTQIVHPFDFDFYLCSHFGQGTSKATHYHVLWDEFNSDILQRLIYNMCFTFARCTKPVSLVPPVYYADLVAYRGRMFQEFYN-LQ Solanum_lycopersicum_SlAGOlike3 DESV-SLHANHFPVDFILHYDIREKWAYDGIRNIYSA-VDL-PLTFK-LV-A-QLQLPRDVLQGMD-LVMKENPRGRCFYSFNGGVKGFQQSLKLTSGLALCLYSELLVIPEIPVIEFLENDLLVGLKVKVTHQKFVIKELLPGETRTLLVDYFLPSLNIGK-GDK-DYVPMEFCDLVEGQRFPKD--LLKTTSLEPKTRTV-LAKDGPMTIP-DNFKIRVDDNMTQISGRILPVPCQWN--LVGKSLQRWALIDFSVKLKDVENLLKVVQ-MILCVMTS--KLKWVSETKIGIVTQCC-QYIVNLCMKINAKLGGSNMELDDNVMFIGADVNHPGKD-APSIAAVVAANKYAARVSPQKRTEK--IIEFDLVLTYKPNKIVVF-RDGVSDSQFDMVLNEELTDLANAIPAITLVVAQKRHHTRLFE-GNVSPTVVDTQIVHPSGFDFYLCSHYGQGTSKATHYHVLYDDFISVDLQRLIYNMCFTFARCTKPVSLVPPVYYADLVAYRGRMFQEFYD-LH Sorghum_bicolor_SbAGO10a GARC-VVKANHFLAELLTQYDIMAELAYDGRKNLYTA-GTL-PVAIK-FA-A-RADLPQEALQVLD-IVLRELANGRSFYSLGDGLCGFYQSIRPTQGLSLNIMS-STAFIELPVIEFVAQKALRGVKVEVTHRKYRISGLTTQPTHESVVEYFLPCLQVGN-QKK-AYLPMEACKIVEGQRYTKRTSLLKVTCQRPREQTV-HQN-GYDPYA-KEFGINISEKLTSVEARVLPAPGQWN--MVNKKVSHWACINFSQELAQVVKALKNVE-LLLAILPD--NIKRICETDLGLITQCC-QYLANVSLKINVKMGGRNTVLDIPTIIFGADVTHPTGE-DPSIAAVVAVTKYAGLVCAQARQEL--IQDLELLISFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADEMQTLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRARFYMELPA-VK Sorghum_bicolor_SbAGO10b GDRC-IVKANHFFAELLHQYDVMGELAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTGRSFYSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVAQKALRGVKVEVTHRKYRISGLTSQATRETVVQYFLPCLQVGN-QQR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPQERTV-HHN-AYDPYA-QEFGIRIDERLAAVEARVLPPPGQWN--MMNKKVSNWACINFSHELAVVERALKARD-LLIVILPD--NLKRICETDLGLVSQCC-QYLANVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAVTKYAGLVSAQARQEL--IQDLELLISFKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADELQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Sorghum_bicolor_SbAGO10c GSRC-IVKANHFIAELLHQYDVMGELAYDGRKSLYTA-GAL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTGRSFYSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVTEFVAQKALRGVKVEVTHRKYRISGLTSQATRETVVQYFLPCLQVGN-QQR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPHERTV-HHN-AYDPYA-QEFGIRIDERLASVEARVLPPPGQWN--MMNKKVSSWACINFSHELALVERALKGRD-LLIVILPD--NLKRICETDLGLVSQCCQQYLANVALKINVKVGGRNTVLDVPTIIFGADVTHPPGE-DPSIAAVVAVTKYAGLVSAQTRQEL--IQDLELLISFKPKRIIFY-RDGVSEGQFYQVLLHELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGLQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Sorghum_bicolor_SbAGO1a GTRC-LVKANHFFAELLHHYDIIKELAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPSGRSFFSLGDGLRGFYQSIRPTQGLSLNIMS-ATAFIELPVIEFVAQKALRGVKVEVTHRKYRISGLTTQATRESVVQYFLPCLQVGN-QQR-PYLPMEVCKIVEGQRYSKRRALLEETCQHPRDRMV-KQN-AYDDYA-QEFGIKISDRLASVEARILPAPGQWN--MMNKKVRSWICVNFAHELALVERALKARD-LLIGILPD--NLKRVCEIDLGIVSQCC-QILANLALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAVTKYAGLVCAQARQEL--IEDLELLVSFKPQRIIFY-RDGVSEGQFYQVLLYELNAIRKACPKVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFSADELQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Sorghum_bicolor_SbAGO1b GTRC-LVKANHFFAELLHQYDVMEELAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTGRSFFSLGEGIRGFYQSIRPTQGLSLNIMS-ATAFFELPVIDFVAQKALRGVKVEVTHRKYRIAGLTSLATRESVVQYFLPCLQVGN-QQH-PYLPMEVCKIVEGQRYSKRRALLEETCQRPHDRMV-NHN-SYDPYA-KEFGIKISERLASIEARILPAPGQWN--MMNK----------------VERALKARD-LLIGILPD--NLKRICEIDLGLVSQCC-QILANLALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAVTKYAGLVSAQSRQEL--IEDLELLISFKPQRILFY-RDGVSEGQFYQVLLHELDAIRKACPQVTFIVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFFLCSHAGIGTSRPAHYHVLWDEFTADALQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPV-LK Sorghum_bicolor_SbAGO4 GQLA-QLYSNHFKVAVFFHYYVIDKLAYDGEKSLFTV-GGL-PVEIN-FA-A-KVPMSLEALRVLD-IILRQHSAKQSFFYLGGGVRGFHSSFRGTQGLSLNVVS-TTMIVKGPVIDFLLSRALKGLRIRTTPAEFKIFGLSERICKETVYDYYLPCINTGR-AKR-PYFPIELCCLVPLQRYTKASSLVEKSRQKPQERAL-QRS-NYDPML-RACGVSVAPKFTQVEGRILQAPGRWN--FTNRKVDKWAVVNFSRDLMRVDDMFGQIR-FLMCLLPE-RKWKRKCLAEFGIVTQCL-PYLLNLLMKINAKLGGLNSLLEVPTIILGMDVSHGPGQ--PSVAAVVSISKYRASVHTQSRLEM--MSSLESLIDFKPDHIIIF-RDGVSESQFTQVINIELDQIIEACPKFTVIVAQKNHHTKFFP-DNVLPTVVDNKVCHPKNFDFYMCAHAGMGTTRPTHYHVLHDEFSADEMQEFVHSLSYVYQRSTTAISVVAPICYAHLAAAQVGTFLKLPR-LH Sorghum_bicolor_SbAGO7 GTAI-PLYANHFLVCFIFHYDIKNKLAFDGRKNLFSP-IQF-QVNLR-LV-S-KLSGPQEYLHALD-VILREGAMGRSLYPIGGGARGFFQSLRPTKGLALNVLS-LTAFHETGIIAYLQKKALKNIRVFVCHQRYHVHGLTEETTENTVVDYFLPCLQIGK--SK-PYVPMELCMVCEGQKFLGKSKMLRMGCQRPSERVV-EGAFGTNSYA-DQFNLQVSKDMTQLLGRVLLPPRQWS--LMDSHIKSWALISFGNQLSSLESKLKKIQ-LLICVMER--RLKRIAETSIGVLTQCC-QFLANLALKINAKVGGSNVALKEPVMFMGADVTHPPLD-DPSVVAVVAANKYISRMRSQTRKEI--IERLELLEEFLPSRIIFF-RDGVSETLFYKVLTEELQAVRLACPAITFVVVQKRQHTRLFD-QNVPPTVVDTVITHPREFDFYLCSHWGTGTSRPTHYRVLWDEFKSDEMQQLIHNLCYTFARCTKPVSLVPPAYYAHLAAYRGRLYLELPK-LR Spodoptera_litura_SplAGO1 GRPI-MLRANHFQISMVHHYDIVETMVFDGRNNLYTR-DPL-PVSIK-WV-A-QVSLPYDAILALD-VVMRHLPSGRSFFSLGGGRFGFHQSVRPSQKMMLNIVS-ATAFYKQPVIEFMCEKEIKGLKIEITHRKYRVCNVTRRPSQMTVAKYFLPCLQVGQ-EHK-HYLPLEVCNIVPGQRCIKKSTMIKATARSAPDRLV-RRA-NFDLYV-KEFGLTISNNMMEVRGRVLPPPGVWD--MRGKQIRVWAIACFAQQLQKVEPMFKYLQ-LVVVVLPG--KVKRVGDTVLGMATQCV-QTLSNLCLKINVKLGGINSILNEPVIFLGVDVTHPAGD-NPSIAAVVGPSRYAATVRVQQKQEI--VHEMELLIMFKPHRIIMY-RDGISEGQFLHVLQHELTAVREACPGITFIVVQKRHHTRLFS-GNIPATTVDLGITHPTEFDFYLCSHQGIGTSRPSHYHVLWDDFGSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVAIT-VH Spodoptera_litura_SplAGO2 AAHI-RVMVNYLEMEFIYRYDVFLKVAFDQMKNCYSL-NPL-KVSLK-AT-G-VVDLPTEEIQCID-VILRQGALGRQFFKLGYGYTGLFQSAIFTNS-FINIVA-HKGFPRQSVLDAMIKLFVKGLKVVATLREFICNGLVGPP-NESVAEYFLNCLWVGN-KDR-CYFPIELLHVAEGQALTRQSKMVKEAATPPDERVI-SNM-KYNRDF-KRFGLEISEKFYTVKAKVLEPPGQWQ----ANRLTSWALIAVDDLIVSLHSILMNAR-FVFIVVSS--RVKQLAEREVGILTQCI-MTAKNLLLKVNSKLMGINQAIDAPVMIVGADVTHPPDQ-SPSIAAVTACYIYNIELSIQTKKEM--IVEFDHLKIYLPKKIFVF-RDGVSEGQFKQVMNSELAAVHNAYPEVLFLLVQKRHHTRLFQ-YNVEPTVVDTDIVHASELDFYLVSHQAIGTARPTRYHTVCNDIPDDEVEQLTYYLCHLYSRCMRSVSYPTPTYYAHLACLRARSLTHKPKRLH Strongylocentrotus_purpuratus_SpAGO1 GRPI-ALRANHFQVKILFHYEVIDTLVFDGRTNMYCK-DEI-PASIK-FE-G-KVSLPHEAVQALD-VIMRHLPSGRSFFSLGGGRFGFHQSIRPSMKMMLNIVS-ATAFYSQSVIDFLCEKEIKGLKIEITHRKYRVCNVTKRSAQTTVAKYFLPCLQVGQ-EQR-HYLPLEVCNIVAGQRCIKKSTMIKATARSAPDRLV-HKA-DFDQYV-RQFGLSISNEMVTIEGRVLPAPGVWD--MRGKQIEVWAIACFALQLQKVEAMFRHLQ-LIIVVLPG--KVKRVGDILLGIATQCV-QTLSNLCLKIKVKLGGVNNILSEPVIFCGADVTHPAGD-DPSIAAVVGPSRYCASVRIQTRVEI--IQDLELLVEFKPARIIMY-RDGVSEGQFLQVLANEMNAIRDACPGITFIVVQKRHHTRLFS-GNIPATTVDSGITHPLEYDFYLCSHAGIGTSRPSHYHVLWDDFKADELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVAIK-VH Sus_scrofa_SsAGO2 GRTI-KLQANFFEMDIIYHYEIVEHMVFDGRKNLYTA-MPL-PVSIK-WV-S-CVSLPFETIQALD-VVMRHLPSGRSFFTLGGGRFGFHQSVRPSLKMMLNIVS-ATAFYKQPVIEFVCEKEIKGLKVEITHRKYRVCNVTRRPASHTVAQYFLPCLQVGQ-EQK-HYLPLEVCNIVAGQRCIKKSTMIRAAARSAPDRLM-RSA-SFDPYV-REFGIMVKDEMTDVTGRVLQPPGVWD--MRNKQIKVWAIACFAEQLRKVEPMFRHLQ-LVVVILPG--KVKRVGDTVLGMATQCV-QTLSNLCLKINVKLGGVNNILQQPVIFLGADVTHPAGD-GPSIAAVVGPNRYCATVRVQQRQEI--IQDLELLIQFKPTRIIFY-RDGVSEGQFQQVLHHELLAIREACPGITFIVVQKRHHTRLFS-GNIPATTVDTKITHPTEFDFYLCSHAGIGTSRPSHYHVLWDDFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVAVQ-VH Thellungiella_halophila_ThAGO1 GKRC-IVKANHFFAELLHQYDVMKQLAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPTGRSFYSLGDGLRGFYQSIRPTQGLSLNIMS-STAFIELPVTEFVCQKALRGVKVEVTHRKYRISGLTAVATRESVVEYFLPCLQVGN-SNR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPLERTV-QLN-AYDPYA-KEFGIKISATLASVEARILPPPGQWN--MMNKKVSNWICINFSQELAQVEKVLKTRD-LLIVILPD--NLKRICETELGIVSQCC-QYMANVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAITKYAGLVCAQARQEL--IQDLELLIAFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFSADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPP-LK Thellungiella_halophila_ThAGO10 GTKC-IVKANHFLADLLNQYDIIAELAYDGRKSLYTA-GEL-PVAIK-FV-A-RANMPQEALQILD-IVLRELSVGRSFFSLGEGLCGFYQSIRPTQGLSLNIMA-SAAFIELPVIEFVAQKGLRGVKVEVTHRKYRVAGLTTQPTRESVIEYFLPCLQVGN-QKK-AYLPMEACKIVEGQRYTKRTALLKVTCQRPRDRTV-QHN-AYDPYA-KEFGVKISEKLASVEARILPAPGQWN--MMNKKVSRWACVNFSNELGQVEKALKHVE-LLLAILPD--NLKRICETELGLISQCC-QYLANVSLKINVKMGGRNTVLDIPTIIFGADVTHPNGE-EPSIAAVVAVTKYAGLVCAQARQEL--IQDLDLLISFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFIVVQKRHHTRLFS-GNILPTVVDTKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRARFYMELPA-LK Thellungiella_halophila_ThAGO2 VRRV-NLFVNHFRVNFIGHYDVRDKVAYDGQKNIFSA-AKL-PFTIK-QV-N-ELKFPRDVLQGMD-VVMKEHPSGKSFFTFGFGVKGYRHTLKPTAGLSLCLYS-VLAFRKMSVIDYLKLNELNGLQVTVTHQKLKIVGLSKKDTKNSIVEYFIPCLDLGK-NGR-QLVPMEFCVLVEGQIYPKELWLKKLSLVNPQQRMI-RSDDGPGEIT-GNFGMKVDTKMTPVEGRVLKAPNQWN--LMRKGVKHWAVIDFTDQLMKLEELLRQVT-FVLCPMSR--TLKWIAETKLGLVTQCF-QYRANLALKINAKVGGSNVELEDQVMFIGADVNHPAHN-KPSIVAVVGANRYAARVIAQPRKEE--IQGFELVKAHRPNKIVIF-RDGVSDGQFDMVLNVELLDVKLTFPKITVIVAQKRHQTRFFK-GNVPSTVVDTKVIHPFEYDFYLCSHHGGGTSKPTHYYTLWDEFTSDQIQKLIFEMCFTFTRCTKPVSLVPPVYYADMVAFRGRIYYEVFK-LH Thellungiella_halophila_ThAGO4 GQKI-PLLTNHFKVNVFYHYSVLDKVAYDGEKTLFTF-GAL-PVEIS-YA-A-KIPLSQEAIRVLD-IILRQHAARQSFFHVGGNIRGFHSSFRTTQGMSLNMVT-TTMIIKGPVVDFVIARTLKNLRIKVSPQEYRITGMSDKLCKDTVAEYFLPCINVGK-PKK-PYIPLELCSLIPLQRYTKASALVEKSRQKPQERAL-KVS-NYEPLL-RSCGISISSNFTQVEGRVLPAPGRWN--FNNKQIEKWAVANFSDDLIRVEKMFEEIQ-FLLCLLPE-RKWKRKNLTEYGIVTQCM-QYLTNCLLKINAKLGGLNSVLKVPTIILGMDVSHGPGQ-SPSIAAVVSISKYRASVRTQPKAEM--IESLELLVDFKPEHIIIF-RDGVSESQFNQVLNIELDQIMEACPKFLVLVAQKNHHTKFFP-DNVPPTIIDNKICHPNNYDFYLCAHAGMGTTRPTHYHVLFDDFSPDELQELVHSLSYVYQRSTTAISVVAPICYAHLAAAQLGTFMKLPR-LK Thellungiella_halophila_ThAGO5 GKKL-TIRANHFLVQVLYHYDVMTTLAYDGRKSIYTA-GPL-PVAIK-LA-S-RPDLPYEAIQVLD-VVLRDTPSGRSFFDLGDGVGGYFQSLRLTQGLSLNIVS-ARSFYEILVTDFIIKKALKSLRVELAHRSSKISGISSCPISQTVVQYFLPAIQSGS-DSK-PYLPMELCQIAEGQRYTKKTALLRATCQRPPERMV-KKN-GYIKLVSKEFGMSVTDQLASVEARVLPPPGQWN--MIDKKVATWTCVSFSKQLTGIEEALRDIQ-LLIVILPD--LIKRICETELGIVSQCC-QYMENVALKINVKSGGRNTVLDRPTIIMGADVTHPPGE-DPSIAAVVAITKYRGLVSAQAREEI--IQDLEHLMAFKPQRIIFF-RDGVSEGQFNQVLLHETHAIHKATPRITFVIVQKRHHTRLFS-GNILPTVVDTKICHPTEFDFYLNSHSGIGTSRPAHYHVLYDDFTADALQMLTNNLCYTFARCTRSVSIVPPAYYAHLAAFRARYYMELPA-IK Thellungiella_halophila_ThAGO6 GSRI-ELSSNHFNVSVFYQYTLIDQLAYDGEKTLYTV-GPL-PVQIQ-FS-T-KIPFAHDPLRVLD-TVLRQQAARQAFFHVGEGVRGFHSTFRPTHGLSLNIVS-TTMILKGPVIEFLKAKMLKNLRVKASHMEFKIIGLSEKPCNQTVYEYFFPCLDVGK-PNR-PYLPLEFCSLVSLQRYTKAASLVEKSRQKPLERAM-GTY-RYNPFL-AGCGISIEKQMTLVEGRVLNPPGRWN--FNNKIIKDWAVVNFSRELISVEKMIAKMF-FVLCVLPE-RKWKKVCLTEAGINTQCI-QYLTNVLLKINSKLGGINSLLKIPTLILGMDVSHGPGR-APSIAAVVGISRYRAAVRTQSKLEM--IDSLELFLEFKPKQIIIF-RDGVSESQFNQVLNIEVDQIIKAYPKFTVIVAQKNHHTKLFH-ENVPATVVDTKIVHPTNYDFYMCAHAGIGTSRPAHYHVLLNEFSPDDLQNIIHCLSYVNQRSTTATSIVAPVRYAHLAAAQFAQFNKLPR-LD Thellungiella_halophila_ThAGO7 GSFI-YLLANHFLVKFIYHYNIKQKLAFDGRKNIYSP-VEF-QVNMR-LV-S-KFDGPQEYIHALD-VILRENPTGRSFYSIGGGARGFFQSLRQTQGLALNMLS-ITAFHEIGVIAYLQKKALTNIRVFVCHQRYRVYGLTKEVTENRLMSYFLPCLQISR--TR-PYLPMELCMICEGQKFLGKAKIMKMGCQRPNERVM-SGPVGPGNQT-REFNLKVSSEMTLLKGRILQPPRPRN--LVESRIERWALMSIGNELTQLESKLKEIQ-LIICVMEK--KLKRIAETRIGVVTQCC-QFVANLALKINAKIGGSMAELDEPVIFMGADVTHPPFD-DPSVAAVVGANRYVSRMRSQTRQEI--IQDLELLDDFLPSRIIFF-RDGVSETQFKKILQEELQSIKTACPSITFAVVQKRHHTRLFH-ENIPPTVVDTVITHPKEFDFYLCSHLGVGTSRPTHYHILWDEFTSDELQRLVYNLCYTFVRCTKPVSIVPPAYYAHLAAYRGRLYIELPR-LS Thellungiella_halophila_ThAGO8 GQKI-QLRTNHFR--------ILENVAYDGDKTLFTV-GPL-PVAIT-FA-K-QISILQDAIRVLD-VILRQNAARQSFFHEHGGFRGFHSSFRTTQGLSLNMVS-STLIVKGPVVDFLTARTLKNLRVKVITQEYKITGLSRLPCKDKVFDYYLRCINVGK-PKR-PYFPMELCHLVSLQRYTKASNLVRESIQKPLDKAL-ENC-NYDTLL-QECGVRIGSEFTQVEGHILPTPGRWN--FNNKEVTGWAVVNFSRDLIRVEKMFEVME-FLLCIL---SKWKKRTLIEDGIKNQCI-QYLTNVLLKINAKLGGLNSELRVPTIIIGMDVSHGPGQ-SPSISAVVSISKYKACVRTQSKVEM--IDNLELLDDFKPDHIIVF-RDGLSESQFNQVLNIELGQMKQACPKFTVIIAQKKHHTRFFPADNVPPTIIDSKICHPRNNDFYLCAHAGMGTTRPTHYHVLYDEFSTDDLQELVHSLSYVYQRSTTAISVDFAAFFHDKGTA-----MKMPK-LN Thellungiella_halophila_ThAGO9 GQKI-PLLTNHFRVNFFFHYSILDKVAYDGEKTLFTV-GAL-PVEIS-YA-A-KIPMLQDAIRVLD-IILRQSAARQSFFHIGGGVRGFHSSFRTTQGLSLNITS-TTMVVQGPVVDFLLSRVLKNLRVKVAPREYKISGLSEERCKDTVYEYFVPCINVGK-PKR-PYIPMEHCELVTLQRYTKSASLVEKSRQKPTERGL-KKS-NYDLVL-RESGVSIGSNFTQVEGRVLPAPGRWN--FNNKKVTRWAVVNFSPDLIRVDKMFEQIK-FLLCILAE-RKWKKKNLAELGIVTQCI-QYITNVLLKINAKLGGLNSLLQVPTIIVGMDVSHGPGM-SLSVAAVVSISKYKACVRTQSKVEM--IDNLELLIDFKPDHIIIF-RDGVSESQFNQVLNIELDQMMQACPKFTVIIAQKNHHIKFFP-DNVPPTIIDNKICHPRNNDFYLCAHAGMGTTRPTHYHVLFDQFSTDDLQELVHSLSYVYQRSTTAISVVAPICYAHLAAAQMGTVMKMPT-LN Tribolium_castaneum_TcAGO1a GRPI-GLKANHFQVTMVHHYDIIETMVFDGRNNLYTR-DPL-PVTIK-WV-A-QVSLPYEAILALD-VVMRHLPSGRSFFSLGGGRFGFHQSVRPSQKMMLNIVS-ATAFYKQPVIEFMCEKEIKGLKIEITHRKYRVCNVTRRPAQMTVAKYFLPCLQVGQ-EHK-HYLPLEVCNIVAGQRCIKKSTMIKATARSAPDRLV-RRA-DFDPYV-QEFGLTISNNMMEVRGRVLPPPGVWD--MRGKQIRVWAIACFAQQLQKVEPMFRYLQ-LVVVVLPG--KVKRVGDTVLGMATQCV-QTLSNLCLKINVKLGGINSILNEPVIFLGADVTHPAGD-NPSIAAVVGPSRYAATVRVQQRQEI--IQELELLIMFKPHRIILY-RDGVSEGQFLQLLQHELTAIREACPGITFIVVQKRHHTRLFS-GNIPATTVDVGITHPTEFDFYLCSHQGIGTSRPSHYHVLWDDLDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVAIT-VH Tribolium_castaneum_TcAGO1b GRPI-GLKANHFQVTMVHHYDIIETMVFDGRNNLYTR-DPL-PVTIK-WV-A-QVSLPYEAILALD-VVMRHLPSGRSFFSLGGGRFGFHQSVRPSQKMMLNIVS-ATAFYKQPVIEFMCEKEIKGLKIEITHRKYRVCNVTRRPAQMTVAKYFLPCLQVGQ-EHK-HYLPLEVCNIVAGQRCIKKSTMIKATARSAPDRLV-RRA-DFDPYV-QEFGLTISNNMMEVRGRVLPPPGVWD--MRGKQIRVWAIACFAQQLQKVEPMFRYLQ-LVVVVLPG--KVKRVGDTVLGMATQCV-QTLSNLCLKINVKLGGINSILNEPVIFLGADVTHPAGD-NPSIAAVVGPSRYAATVRVQQRQEI--IQELELLIMFKPHRIILY-RDGVSEGQFLQLLQHELTAIREACPGITFIVVQKRHHTRLFS-GNIPATTVDVGITHPTEFDFYLCSHQGIGTSRPSHYHVLWDDLDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVAIT-VH Tribolium_castaneum_TcAGO2a GRPI-KIESNHLSLNVAYHYDVMNLFAFDGRKNLYSP-KKL-PVVVK-LA-R-TVDLPQDALQCLD-IVLRNAPSGRCFFTLGDGMYGFYQSAIRGWQPLLNVVV-HKAFPELNVLDLVCEKFLKQLKVTYEIRIFRVNGLRAPPSQATVEKYYLPTLWVGS-RQR-ELIPLEFCTVVSGQVVNRKSVMIKKAATSTDVRVL-RKA-NYDPCV-REFGFSVNNSFEKLDGRVLQPPGVWR--ADMNRVHKWTIVSCTDMIFRLRDIIDYFD-LIIVVVPN---VKQAAELNVGCLTQCI-QIIANILLKINSKLNGTNHILSRPCIIMGADVTHPPDA-KPSVAAVTAAFQYNICWRLQPKVEI--IEDLEQLMFFKPETIVFF-RDGVSEGQFAEVRRAEISAIHQACPRITFLVVQKRHHTRLFN-NNVPATCVDTHITNPMMQDFYLVSHASIGVAKPTKYCTLWDDMSNDDIEELTYYLCHMFTRCNRSVSYPAPTYYAHLAAARAKVYVE----IQ Tribolium_castaneum_TcAGO2b GRRI-QIESNHLSLNLAYHYDVMNLFAFDGRKNLYSP-KKL-PVEVK-LA-R-TVDLPQDALQCLD-IVLRNAPSGRCFFTLGDGMYGFYQSAIRGW-ALLNVVA-HKAFPKSNVLDIVCEKFIKQLKVKYEIRIHRVNGLGEPPSQATVERYYLPTLWVGS-RER-ELLPLEFCTVVGGQAINRKSAMIRKAATSTDVRTL-RTA-NYDPCI-REFGFSVSNNFEKLDARVLNPPGVWR--ADRNRINKWTIASGTDMIFRLRDFIDYFD-LIIVVVPN---VKQAAELNVGCLTQCI-QTVGNILLKINSKMNGTNHRLKRPCMIMGADVTHPPDA-RPSVAAVTAAFQYNICWRLQPKVEI--IEDLEQLKFFKPESIVFF-RDGVSEGQFKQVQRAEIAAIQKACPKITFLVVQKRHHTRLFN-NNVPATCVDTHITNPRMQDFYLVSHASIGVAKPTKYCTLWDDMNNDDIEELTYHLCHMFTRCNRSVSYPAPTYYAHLAAARAKVYIE----IQ Tribolium_castaneum_TcAGO3 GTPI-KATANYILLNVVFEYELVNQAVYDGDVCLYLPCLAFSPTTLI-YK-R-KRKL-SECLHLYN-VLFKRIMHGRNYFSPQHKLPGFCVHVDEMEGLMVCLTQ-HRVIRSQTVYELFHEKNVIGACVLTKYRTYIIDDIAWNMNPKCFIDYYQPLLITRQ-VKQSPCLIPELCYLTGLTDAMRNKDVAAFTRITPNQRYLDRVRQSEKQVL-SGWGLSLADDTVDVKARVLPQETDWNKAISDNKITNWQLYYTRQTIVRTETYMTAIQ-VAVFICPT--LIKKMCCVNIPVASQVI-TIIHKIAMQITCKLGGTLWSV-SGWMVCGIDVYHGNNQ---SVCGFVAMTKYFSKAMFQD------IGDYQMLQAAFPSKVIVF-RDGVGDGQLEHCRKYEITQLQEVITTITFVVVQKRINTRIFF-ENPPSTVVDNMVTRRQFYDFFLVPQSVRGTVNPTHYVVLVDEIKPDHLQRLAYKLCHLYYNWSGTIRVPAPCLYAHKLAAIVGQYIKTPS--- Trichuris_trichiura_TtAGO2 GRPI-VLRANHFQVRIIHHYDIVTTMVYDGKKNMYTR-EPL-PVTIK-WI-S-QVSLPYESVQAID-VILRHLPSGRSFFSLGGGRFGFHQSVRPSQKMMLNIVS-ATAFYRMPVIEFLAEKEIKGLKCEITHRKYRVCNVTRRPAQTTVAKYFLPCLQVGQ-EQK-HYLPPEVCNIVPGQRCIKKSTMIRATARSAPERLV-RKA-DFDPFA-HEFGIAINPTMTEVKGRVLSAPGVWD--MRGKQIKVWAIACFAQQLLRVEPMFRYLQ-LIVIVLPG--KVKRVGDTILGIATQCV-QTLSNLCLKINVKLGGVNSILNEPIIFMGADITHPAGD-SPSISAVVGPSRYAATVRIQQRQEI--ITDLELLIQFKPTRILLY-RDGVSEGQFFNVLQHELRAMREACPGITFVAVQKRHHTRLFA-FNIPPTTVDVGITHPTEFDFFLCSHAGIGTSRPSHYHVLWDDLSADELQQLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVAVQ-VH Vitis_vinifera_VvAGO10like GTKC-IVKANHFFTELLNQYDIMNELAYDGRKSLYTA-GEL-PVVIK-FV-A-RASLPQEALQILD-IVLRELSTGRSFFSLGEGLCGFYQSIRPTQGLSLNIMS-SAAFIELPVIEFVGQKALRGVKVEVTHRKYRVSGLTSQPTRESVVEYFLPCLQVGN-QKK-AYLPLEACKIVEGQRYTKRTALLKVTCQRPRDQTV-QHN-AYDPYA-KEFGIKISEKLASVEARILPAPGQWN--MMNKKVSRWACINFSNELAQVEKALKHVE-LLLAILPD--NLKRICETDLGLISQCC-QYLANVSLKINVKMGGRNTVLDIPTIIFGADVTHPNGE-DPSIAAVVAVTKYAGLVCAQARQEL--IQDLDLLVSFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFIVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGIQSLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRARFYMELPA-LK Vitis_vinifera_VvAGO16like GRRI-SLLTNHFKVSMFYQYSVIDRLAYDGEKSLYTV-GPL-PVAIS-YA-A-KIPLAQDALRVLD-IILRQQAARQSFFHVGGGVRGFHSSFRTTQGLSLNMVS-TTMILTGPVIDFLLAKMLKNMRIKTKHMEFKITGLSEKPCNLTVYEYFMPCLNVGK-PKR-PYLPLELCLLVSLQRYTKASTLVEKSRQKPQDRAV-RNY-QYDPVL-SACGISIDRQLTQVDGRVLEAPGRWN--FNHKKIERWAVVNFSRELINVEKMFEIVE-FLLCVLPE-KKWKKRSLSDFGIVTQCI-QYLTNVLLKINTKLGGTNSLLDTPTMILGMDVSHGPGQ-APSIAAVVGISRYRASVRTQSKVEM--IDALELLVDFKPAQIVIF-RDGVSESQFNQVLNIELEQIMKAYPKFTVIVAQKNHHTKLFP-ENVPPTVVDTKIVHPRNYDFYMCAHAGMGTSRPAHYHVLLDEFSPDDLQHLIHSLSYVYQRSTTAISIVAPVCYAHLAAQQMGQFIKLPR-LH Vitis_vinifera_VvAGO1Blike GVTT-IVGGKSNVAGYSRDFDVIGAV----------------SYYLK-LA-A-RADLPQEALQVLD-IVLRELPTGGSFYSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVTQKALRGVKVEVTHRKYRISGLTSQATRESVFEYFWPCLQVGN-QQR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPQERTI-HHN-AYDPYA-KEFGIKISEKLASVEARILPAPGQWN--MMNKKVNNWIGINFSQEFAQVERVLKARD-LLIVILPD--NLKRICETDLGLVSQCC-QYLANVALRINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIVAVVAITKYAGLVCAQARQGL--IQDLELLISFKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTS?PAHYHVLWDEFTADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELLA-LK Vitis_vinifera_VvAGO1like GKKC-IVKANHFFAELLHQYDVMEQLAYDGRKSLYTA-GPL-PVVIK-LA-A-RADLPQEALQVLD-IVLRELPTGRSFYSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVTQKALRGVKVEVTHRKYRISGLTSQATRESVVEYFWPCLQVGN-QQR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPQERTV-HHN-AYDPYA-KEFGIKISEKLASVEARILPAPGQWN--MMNKKVNNWICINFSQELAQVERVLKARD-LLIVILPD--NLKRICETDLGLVSQCC-QYLANVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAITKYAGLVCAQARQEL--IQDLELLISFKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Vitis_vinifera_VvAGO2like IQST-MVRVNHFPVKFILHYDIKEKLAFDGEKNIFSV-VEL-PFTIK-LV-N-QLELPREILQGMD-VVMKENPAGRSFYPLGHGIRGFLHSLKPTAGLTLCLYS-VLAFRKIPVIDFLEEVALKGLKVRVIHQKYTISGLSGEDTRYGIIDYFIPCLDLGK-NNR-KYVPMEFCILTEGQRFLKEQKLKNLSLVAPKVRMV-RSKTGPGDMI-NNFGIEVNMRMTTVAGRVIMAPCHWN--FVGKSIDRWAVLDFSPKFIRLRELLLGVQ-ILVCVMAR--KLKWFCETNIGIVTQCC-QYLANLALKMNAKLGGSNVELEGYVMFVGADVNHPAWN-SPSIAAVVAVNRYAARVRPQLRTEK--ILNFELIETYKPDKIVVF-RDGVSEGQFDMVLNEELVDLKGAIPTITLIITQKRHQTRLFN-ENVSPTVVDTTVVHPFEFDFYLCSHYGGGTSKPTHYHVLYDEFSSDQLQKLIYNLCFTFVRCTKPVSLVPPVYYADLAAYRGRLYHDFYR-LH Vitis_vinifera_VvAGO4 GQKI-ALTTNHFKVNVFFHYSVIDRVAYDGEKSLFTV-GPL-PVEIS-FA-A-KIPMSQEALRVLD-IILRQHASRQSFFHLGGGVRGFHSSFRTTQGLSLNIVS-TTMIVQGPVVDFLIAKMLKNLRVKTSPTEYKITGLSEKPCKETVFDYFLPCINVGK-PKR-PYFPIELCTLVSLQRYTKAASLVERSRQKPQERAL-RSN-NYEPML-RSCGISISRDLTQIEGRVLAAPGRWN--FNNKKIERWAVVNFSRELIKVEKMFEEIQ-FLLCLLPE-RKWKRKNLSEYGIVTQCI-QYLTNVLLKINAKLGGLNSMLKGPTIILGMDVSHGPGQ-SPSIAAVVSISRYRASVRTQSKVEM--IDSLELLLDFKPDQIIIF-RDGVSESQFNQVLNIELDQIIEACPKFVVIVAQKNHHTKFFP-DNVPPTVIDNKVCHPRNNDFYLCAHAGMGTTRPTHYHVLLDEFSSDDLQELVHSLSYVYQRSTTAISVVAPICYAHLAATQMSQFMKLPK-LQ Vitis_vinifera_VvAGO4Alike GETI-QLVTNHFKVSMFYQYNVMDKVAYDGEKSLFTI-GSL-PVEIS-FA-A-KFPMLQDAARVLD-IILRQHAARQSFFDLGGGVRGFNSSFRATQGLFLNMVS-TTLVIQDPVRDFLVSRMLKNLRVKTLHAEWKISGLSERTCRNTVYDYFFPCINVGR-SKH-PYIPLELCTLVSLQRYTKPSSLVEKSRQKPQERAL-KSN-KYNPML-RSSGISISTQFTQVEGRILPTPGRWN--FNNKEIDPWLIASFSQDLIKVDKMIGTMQ-FILCILPQ-KKWKRQCLSGCGVPIQCI-QYLTNVLLKINAKLGGLNSLLTIPTLILGMDVSHGPGR-PPSIAAVVSISQYRATVRTQSKLEM--IDSLGTLLDFKPEHIIIF-RDGVGESQFNQVLNIELEQIIEACPKFMVIIAQKNHHIRFFP-SNVPPTIVDNTICHPRNNDFYLCAHAGMGTSRPTHYHVLLDEFSADDLQQLVHSLCYVYQRSTTAVSLVAPVCYAHLAAAQVAQFIKLPS-FH Vitis_vinifera_VvAGO5like GRKC-KVRANHFQVQVFCHYDIIKQLAYDGSKSLYTA-GPL-PVAIK-LA-S-KGDLPQETIQILD-VVLRASPSGRSFFSLGDGLRGYYQSLRPTQGLSFNIVS-ARSFYEILVTDFVAKKALKGVKVQLTHKRYKIAGVSSQPTNQSVVQYFWPSLQAGS-DSK-PYLPMEVCKIVEGQRYTRKTALLRATCQRPSERMV-RKN-NFDRVVRDEFGIRINEELTLVDARVLPPPGQWN--MIDKKVQFWTCLNFSRELVNIEKVLVDVQ-LLIIILPD--VIKRICETELGIVSQCC-QYFENVALKINVKVGGRNTVLDLPTIIFGADVTHPPGE-DPSIAAVVAVTKYRGLVSAQHREEI--IQDLELLIAFKPSRIIFY-RDGVSEGQFSQVLLHEMDSIRKACPPVTFVVVQKRHHTRFFS-GNILPTVVDTKICHPTEFDFYLNSHAGIGTSRPTHYHVLYDEFTADILQILTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARYYIELPA-VK Vitis_vinifera_VvAGO7like GPVI-SLLANHFLVQFIFHYDIKRKLAFDGRKNLYSP-VEF-QINIK-LV-S-KFDGPQDYLHALD-IVLRESPTGRSLYSIGGGARGFFQSLRPTQGLALNVFS-VTAFHEIGIIPYLQKKALKNIRVFVCHQRYRVHSLTEETTENRLVNYFLPCLQITS--SK-PYLPMELCMICEGQKFLGKARILKMGCQRPRERVM-RGAVGPGSQE-REFKLDVSREMTRLNGRVLEPPRQWN--LLDSHIERWALISFGIQLSQLESKLKKIQ-LLMCIMER--KLKRIAETSIGVVSQCC-QFLANLALKINAKVGGCTVALDEPVIFMGADVTHPPLD-DPSIAAVVGANKYVSRMRSQTRQEI--IQDLEILDDFLPKRIIFF-RDGVSETQFYKVLQEELQAIRVACPPITFAVVQKRHHTRLFD-DNIPPTVVDAVITHPREFDFYLCSHWGVGTSRPTHYHVLWDDFTSDELQKLVYNLCYTFVRCTKPVSLVPPAYYAHLAAYRGRLYLELPK-LS Vitis_vinifera_VvMEL1like GKRC-RITANHFRVELIHHYHLIKELAYDGRRGIYTA-GPL-PVKIR-FA-T-STDIPYEIIHALD-VVLKDSLSGKTFFPIGNGVNGFYQSLRPTQGLSLNIVS-SKSFYEIPVIEFAAKKVLKGIKVEVTHRRYKIFDITEQPTNQSVIQYFWPSLRSGK-DSR-PYLPMETCTIVAGQRYAKKASMLRMTCQRPWRRIA-DQD-DYNDFV-KEFGVNVSVDMAAIDARVLPPPGQWN--AQHVKVEYWMCVNFSQHLVDIEAKLSDVQ-MLIIILPE--VIKRICETELGMVSQCC-IYLENIVLKINVKAGGQNAILDIPTIIFGADVTHPSGE-DPSIAAVVAVVTYRGLVSAQPRSEI--IEDLELLLAFKPLRIIFF-RDGVSEGMFEMVLLKEMDAIRKACPPVTFIVVQKRHNTRLFS-GNILPTVVDTVICHPSEHDFYLCSHAGIGTSRPAHYRVLLDEFSADALQMLANDLCYTYARCTRSVSIVPPVYYAHLAAFRAKFYVELPE-ID Vitis_vinifera_VvPNH1 GRKC-VVKANHFLAQVLSQYSIMAQLVYDGKRVLYTA-GLL-PVTIK-FV-G-ITSMPHEIIRIFD-IVLNQLAAGRCLYSLGGGLQGFYKSIRPTQGLSLNIMS-STAFIELPVIDFVAQKALRGVKVEVTHRKYRISGLTSQPTRESVVEYFLPCLQVGN-QRK-VYLPMEACKIIGGQRYTKGTSLLKVTCQRPRDRTI-NQN-GYDPYA-KEFGITVDEKLASVEARVLPAPGQWN--MTNKKINYWACINFSHQLVQVKKALKHVE-LLIAILPD--NLKRICDTDLGLISQCC-QYLANVSLKINVKMGGRNTVLDIPTIIFGADVTHPTGD-DPSIAAVVAVTKYAGLVCAQARQEL--IQDLELLLSFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPSEFDFYLCSHAGIGTSRPAHYHVLWDEFTADEIQSLTNNLCYTYARCTRSVSLVPPAYYAHLAAYRARFYMELPA-LN Volvox_carteri_VcAGOlike GRAV-NLFANYFRLQTAYHYDVLKAARFDGRKNLYLP-GQGIPVTTK-HV-N-VVDLPRDAMQVLD-VVIRHAFAGRGYYYLTGGAKGFQQSFKLVEGLMLNLSS-FAAFMSRSLPELLAERNLSGFKVTFPMRKKPMIGLSEQGAANSVAEYFLPCANVGN-RMK-PYIPVELCTVVAGQRRMK-AGMISAAKQDPRTKQARRVQSTLSGTE-AKWGLKLNTDLMRLPGRLLPTPGSWN--LRDVKLDSWAVVCCIIDMCDIENAMRSAK-LLLVILPE--SIKRVSDIELGIPSQVV-QYCANVAMKINNKLGGVNVTLALPFMIMGADVTHPRAD-VPSVAAVVAMGRWGSRVLLQTRQEV--ITGMELLLEFKPQRLVMY-RDGVSEGQFDQVLAEEYMAIRKACPAITFIVVQKRHNTRLLK-GNVLPTVVDKGIVAPDGFDFYLNSHAGLGTNKPAHYHVLIDEFGADGVELLTYWLCYLYQRTTKSVSYCPPAYYADRAAFRGRTLLAFAG-IH Xenopus_laevis_XlAGO2 GRTI-KLQANVFEMDIIYHYDIVEHMVFDGRKNLYTA-MPL-PVAIK-WM-A-CVSLPFETVQALD-VVMRHLPSGRSFFTLGGGRFGFHQSVRPSLKMMLNIVS-ATAFYKQPVIEFMCEKEIKGLKVEITHRKYRVCNVTRRPASHTVAQYFLPCLQVGQ-EQK-HYLPLEVCNIVAGQRCIKKSTMIRATARSAPDRLM-RSA-SFDPFV-REFGIMVKDDMTDVTGRVLQPPGVWD--MRNKQIKVWAIACFAEQLRKVEPMFRHLQ-LVVVILPG--KVKRVGDTVLGMATQCV-QTLSNLCLKINVKLGGVNNILQQPVIFLGADVTHPAGD-GPSIAAVVGPNRYCATVRVQQRQEI--IQDLELLIQFKPTRIIFY-RDGVSEGQFQQVLHHELLAIREACPGITFIVVQKRHHTRLFS-GNIPATTVDTKITHPSEFDFYLCSHAGIGTSRPSHYHVLWDDFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVAVQ-VH Zea_mays_ZmAGO10a GARC-VVKANHFLAELLTQYDIMAELAYDGRKNLYTA-GTL-PVAIK-FA-A-RADLPQEALQVLD-IVLRELANGRSFYSLGDGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIEFVAQKALRGVKVEVTHRKYRISGLTTQPTHESVVEYFLPCLQVGN-QKK-AYLPMEACKIIEGQRYTKRTSLLKVTCQRPREQTV-HQN-DYDPYA-KEFGINISEKLTSVEARVLPAPGQWN--MVNKKVSHWACINFSQELAQVVKALKNVE-LLLAILPD--NIKRICETDLGLISQCC-QYLANVSLKINVKMGGRNTVLDIPTIIFGADVTHPTGE-DPSIAAVVAVTKYAGLVCAQARQEL--IQDLELLISFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADEMQTLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRARFYMELPA-VK Zea_mays_ZmAGO10b GARC-VVKANHFLAELLIQYDIMAELAYDGRKNLYTA-GTL-PVAIK-FA-A-RADLPQEALQVLD-IVLRELANGRSFYSLGDGLCGFYQSIRPTQGLSLNIMS-STAFIELPVIEFVAQKALRGVKVEVTHRKYRISGLTTQPTHESVVEYFLPCLQVGN-QKK-AYLPMEACKIVEGQRYTKRTSLLKI--------TV-HQN-GYDPYA-KEFGINISEKLTYVEARVLPAPGQWN--MVNKKVSHWACINFSQELAQVVKALKSVE-LLLAILPD--NIKRICETDLGLISQCC-QYLANVSLKINVKMGGRNTVLDIPTIIFGADVTHPTGE-DPSIAAVVAVTKYAGLVCAQARQEL--IQDLELLISFKPLRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADEMQTLTNNLCYTYARCTRSVSVVPPAYYAHLAAFRARFYMELPA-VK Zea_mays_ZmAGO1a GDRC-IVKANHFFAELLHQYDVMGELAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTGRSFYSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVAQKALRGVKVEVTHRKYRISGLTSQATRETVVQYFLPCLQVGN-QQR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPQERTV-HHN-AYDPYA-QEFGIRIDERLAAVEARVLPPPGQWN--MMNKKVSNWACINFSHELAIVERALKARD-LLIVILPD--ILKRICETDLGLVSQCC-QYLANVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAVTKYAGLVSAQARQEL--IQDLELLISFKPQRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADELQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Zea_mays_ZmAGO1b GSRC-IVKANHFFAELLHQYDVMKELAYDGRKSLYTA-GAL-PVVIK-FA-A-RADLPQEAIQVLD-IVLREFPTGRSFYSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVAQKALRGVKVEVTHRKYRISGLTSQATRETVVQYFLPCLQVGN-QQR-IYLPMEVCKIVEGQRYSKRTALLKVTCQRPQERTV-HHN-AYDPYA-QEFGIKIDERLASVEARVLPPPGQWN--MMNKKVSSWACINFSHDLALVERALKRLD-LLMVILPD--NLKRICETDLGLVSQCCHQYLANVALKINVKVGGRNTVLDVATIIFGADVTHPPGE-DPSIAAVVAVTKYAGLVSAQTRQEL--IQDLELLISFKPKRIIFY-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADGLQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Zea_mays_ZmAGO1c GDRC-IVKANHFFAELLHQYDVMGELAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTGRSFYSLGEGLRGFYQSIRPTQGLSLNIMS-STAFIELPVIDFVAQKALRGVKVEVTHRKYRISGLTSQATRETVVQYFLPCLQVGN-QQR-PYLPMEVCKIVEGQRYSKRTALLKVTCQRPQERTV-HHN-AYDPYA-LEFGIRIDERLAAVEARVLPPPGQWN--MMNKKVSNWACINFSHELAVVERALKARD-LLIVILPD--NLKRICETELGLVSQCC-QYLANVALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAVTKYAGLVSAQARQEL--IQDLEG--NWHILQFLSF-RDGVSEGQFYQVLLYELDAIRKACPPVTFVVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFYLCSHAGIGTSRPAHYHVLWDEFTADELQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Zea_mays_ZmAGO1d GTRC-LVKANHFFAELLHQYDVMEELAYDGRKSLYTA-GPL-PVVIK-FA-A-RADLPQEALQVLD-IVLRELPTGRSFFSLGEGIRGFYQSIRPTQGLSLNIMS-ATAFFELPVIDFVAQKALRGVKVEVTHRKYRIAGLTSQETRESVVQYFLPCLQVGN-QQH-PYLPMEVCKIVEGQRYSKRRALLEETCQRPHDRMM-NHN-SYDPYA-KEFGIKISERLASIEARILPAPGQWN--MMNKKVRSWTCVNFARELARVERALKARDLLLIGILPD--NLKRICEIDLGLVSQCC-QILANLALKINVKVGGRNTVLDRPTIIFGADVTHPPGE-DPSIAAVVAVTKYAGLVSAQSRQEL--IEDLELLISFKPQRILFY-RDGVSEGQFYQVLLHELDAIRKACPQVTFIVVQKRHHTRLFS-GNILPTVVDSKICHPTEFDFFLCSHAGIGTSRPAHYHVLWDEFTADALQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMELPA-LK Zea_mays_ZmAGO4 GQQI-KLITNHFKVSLFYHYYVIEKLAYDGEKSLFTI-GAL-PVELS-FA-A-KIPMTQEAIRVID-IILRQHSARQSFFHLGGGVRGFHSSFRATQGLSLNIVS-TTMIVKGPVIDFLIARSLKNLRIKTSPQEQKIVGLSDRPCRETVFDYFLPCINVGK-PKR-PYFPVELCSLLPLQRYTKASSLVEKSRQKPQERVL-QRS-NYEPML-KACGITIARNFIEVDGRVLQPPGRWN--FNNKKVEKWAVVNFSRDLIKVEDMFEQVK-FLLCVLAE-RKWKKKCLAEFGIVTQCV-QYLTNVLLKINAKLGGLNSLLKVPTIILGMDVSHGPGH-SPSVAAVVSISKYRASVRTQSKMEM--IDSLECLIDFKPDQVIIF-RDGVSESQFNQVLNIELQQIIEACPKFTLIIAQKNHHTKFFP-DNVPATVVDNKVCHPRNFDFYMCSHAGMGTTRPTHYHILHDEFNPDDLQELVHSLSYVYQRSTTAISVVAPICYAHLAAAQVGQFIKLPR-LH ; END; BEGIN TREES; TITLE 'Plant and Animal AGOs - NJ'; LINK TAXA = Taxa1; TRANSLATE 1 Arabidopsis_lyrata_AlAGO10, 2 Arabidopsis_thaliana_AtAGO10, 3 Capsella_rubella_CrbAGO10, 4 Thellungiella_halophila_ThAGO10, 5 Brassica_rapa_BrAGO10, 6 Carica_papaya_CpAGO10, 7 Citrus_sinensis_CsnAGO10, 8 Manihot_esculenta_MeAGO10, 9 Ricinus_communis_RcAGO10a, 10 Populus_trichocarpa_PtAGO10, 11 Vitis_vinifera_VvAGO10like, 12 Malus_domestica_MdAGO10a, 13 Prunus_persica_PprAGO10, 14 Malus_domestica_MdAGO10b, 15 Glycine_max_GmAGO10like, 16 Phaseolus_vulgaris_PvAGO10a, 17 Nicotiana_attenuata_NaAGO10, 18 Malus_domestica_MdAGO1b, 19 Linum_usitatissimum_LuAGO10a, 20 Eucalyptus_grandis_EgAGO10a, 21 Mimulus_guttatus_MgAGO10, 22 Brachypodium_distachyon_BdPNH1like, 23 Sorghum_bicolor_SbAGO10a, 24 Zea_mays_ZmAGO10a, 25 Zea_mays_ZmAGO10b, 26 Oryza_sativa_OsPNH1, 27 Carica_papaya_CpAGO1, 28 Cucumis_sativus_CstAGO1b, 29 Glycine_max_GmPNH1like1, 30 Phaseolus_vulgaris_PvAGO10b, 31 Glycine_max_GmPNH1like2, 32 Medicago_truncatula_MtAGO10, 33 Manihot_esculenta_MeAGO1, 34 Ricinus_communis_RcAGO10b, 35 Vitis_vinifera_VvPNH1, 36 Arabidopsis_lyrata_AlAGO1, 37 Capsella_rubella_CrbAGO1, 38 Arabidopsis_thaliana_AtAGOlike, 39 Arabidopsis_thaliana_AtAGO1, 40 Thellungiella_halophila_ThAGO1, 41 Brassica_rapa_BrAGO1, 42 Brachypodium_distachyon_BdAGO1Alike, 43 Brachypodium_distachyon_BdAGO1Blike, 44 Hordeum_vulgare_HvAGO1a, 45 Sorghum_bicolor_SbAGO10b, 46 Zea_mays_ZmAGO1a, 47 Oryza_sativa_OsAGO1B, 48 Hordeum_vulgare_HvAGO10, 49 Zea_mays_ZmAGO1c, 50 Oryza_sativa_OsAGO1A, 51 Sorghum_bicolor_SbAGO10c, 52 Zea_mays_ZmAGO1b, 53 Citrus_sinensis_CsnAGO1, 54 Ricinus_communis_RcAGO1, 55 Populus_trichocarpa_PtAGO1, 56 Malus_domestica_MdAGO1a, 57 Prunus_persica_PprAGO1a, 58 Glycine_max_GmAGOlike1, 59 Phaseolus_vulgaris_PvAGO1, 60 Cucumis_sativus_CstAGO1a, 61 Eucalyptus_grandis_EgAGO1, 62 Vitis_vinifera_VvAGO1like, 63 Vitis_vinifera_VvAGO1Blike, 64 Mimulus_guttatus_MgAGO1, 65 Nicotiana_attenuata_NaAGO1a, 66 Nicotiana_benthamiana_NbAGO1.1, 67 Nicotiana_tabacum_NtAGO1, 68 Nicotiana_attenuata_NaAGO1b, 69 Nicotiana_benthamiana_NbAGO1.2, 70 Nicotiana_attenuata_NaAGO1c, 71 Pisum_sativum_PsAGO2, 72 Pisum_sativum_PsAGO1, 73 Linum_usitatissimum_LuAGO1, 74 Linum_usitatissimum_LuAGO5, 75 Linum_usitatissimum_LuAGO10b, 76 Brachypodium_distachyon_BdAGO1Dlike, 77 Hordeum_vulgare_HvAGO1b, 78 Oryza_sativa_OsAGO1C, 79 Sorghum_bicolor_SbAGO1a, 80 Oryza_sativa_OsAGO1D, 81 Zea_mays_ZmAGO1d, 82 Sorghum_bicolor_SbAGO1b, 83 Brachypodium_distachyon_BdAGO1Clike, 84 Malus_domestica_MdAGO10c, 85 Prunus_persica_PprAGO1b, 86 Physcomitrella_patens_PptAGO5, 87 Physcomitrella_patens_PptAGO1, 88 Physcomitrella_patens_PptAGO10, 89 Selaginella_moellendorfii_SmAGO10, 90 Selaginella_moellendorfii_SmAGO1a, 91 Eucalyptus_grandis_EgAGO10b, 92 Selaginella_moellendorfii_SmAGO1b, 93 Arabidopsis_lyrata_AlAGO5, 94 Arabidopsis_thaliana_AtAGO5, 95 Capsella_rubella_CrbAGO5, 96 Brassica_rapa_BrAGO5, 97 Thellungiella_halophila_ThAGO5, 98 Citrus_sinensis_CsnAGO5, 99 Citrus_sinensis_CsnAGOlike, 100 Manihot_esculenta_MeAGO5, 101 Manihot_esculenta_MeAGOlike, 102 Ricinus_communis_RcAGO5, 103 Populus_trichocarpa_PtAGOlike2, 104 Populus_trichocarpa_PtAGOlike3, 105 Vitis_vinifera_VvAGO5like, 106 Malus_domestica_MdAGO5b, 107 Malus_domestica_MdAGO5a, 108 Prunus_persica_PprAGO5, 109 Nicotiana_attenuata_NaAGO5, 110 Populus_trichocarpa_PtAGOlike1, 111 Mimulus_guttatus_MgAGO5, 112 Glycine_max_GmAGO5like2, 113 Carica_papaya_CpAGO5, 114 Brachypodium_distachyon_BdMEL1like, 115 Hordeum_vulgare_HvAGO5, 116 Oryza_sativa_OsMLE1, 117 Brachypodium_distachyon_BdMELlike, 118 Oryza_sativa_OsAGO14, 119 Vitis_vinifera_VvMEL1like, 120 Brachypodium_distachyon_BdAGO12like, 121 Oryza_sativa_OsAGO12, 122 Oryza_sativa_OsAGO11, 123 Oryza_sativa_OsAGO17, 124 Oryza_sativa_OsAGO13, 125 Brachypodium_distachyon_BdAGO18like, 126 Oryza_sativa_OsAGO18, 127 Tribolium_castaneum_TcAGO1b, 128 Tribolium_castaneum_TcAGO1a, 129 Drosophila_melanogaster_DmAGO1, 130 Musca_domestica_MudAGO1like, 131 Bombyx_mori_BmoAGO1, 132 Danaus_plexippus_DpAGO1, 133 Spodoptera_litura_SplAGO1, 134 Nilaparvata_lugens_NlAGO1, 135 Homo_sapiens_HsAGO2, 136 Sus_scrofa_SsAGO2, 137 Bos_taurus_BtAGO2, 138 Sarcophilus_harrissi_ShAGO2, 139 Xenopus_laevis_XlAGO2, 140 Danio_rerio_DrAGO2, 141 Crassostrea_gigas_CgAGO2, 142 Ephydatia_fluviatilis_EfAGO, 143 Amphimedon_queenslandica_AqAGO2like1, 144 Oikopleura_dioica_OdAGO2, 145 Trichuris_trichiura_TtAGO2, 146 Brugia_malayi_BmaAGO2, 147 Strongylocentrotus_purpuratus_SpAGO1, 148 Nematostella_vectensis_NvAGO1, 149 Hydra_vulgaris_HyvAGO2like, 150 Nematostella_vectensis_NvAGO2, 151 Amphimedon_queenslandica_AqAGO2like2, 152 Marsupenaeus_japonicus_MjAGO2, 153 Arabidopsis_lyrata_AlAGO7, 154 Arabidopsis_thaliana_AtAGO7, 155 Capsella_rubella_CrbAGO7, 156 Thellungiella_halophila_ThAGO7, 157 Brassica_rapa_BrAGO7, 158 Carica_papaya_CpAGO7, 159 Manihot_esculenta_MeAGO7b, 160 Populus_trichocarpa_PtAGO7, 161 Ricinus_communis_RcAGO7, 162 Manihot_esculenta_MeAGO7a, 163 Malus_domestica_MdAGO7b, 164 Prunus_persica_PprAGO7, 165 Vitis_vinifera_VvAGO7like, 166 Citrus_sinensis_CsnAGO7, 167 Malus_domestica_MdAGO7a, 168 Glycine_max_GmAGO7like, 169 Phaseolus_vulgaris_PvAGO7, 170 Lotus_japonicus_LjAGO7, 171 Medicago_truncatula_MtAGO7, 172 Nicotiana_attenuata_NaAGO7, 173 Eucalyptus_grandis_EgAGO7, 174 Linum_usitatissimum_LuAGO7, 175 Mimulus_guttatus_MgAGO7, 176 Brachypodium_distachyon_BdAGO7like, 177 Oryza_sativa_OsSHL4, 178 Sorghum_bicolor_SbAGO7, 179 Arabidopsis_lyrata_AlAGO3, 180 Arabidopsis_thaliana_AtAGO3, 181 Arabidopsis_lyrata_AlAGO2, 182 Arabidopsis_thaliana_AtAGO2, 183 Capsella_rubella_CrbAGO2, 184 Thellungiella_halophila_ThAGO2, 185 Brassica_rapa_BrAGO2a, 186 Brassica_rapa_BrAGO2b, 187 Capsella_rubella_CrbAGO3, 188 Carica_papaya_CpAGO2, 189 Glycine_max_GmAGO2like1, 190 Medicago_truncatula_MtAGO2, 191 Glycine_max_GmAGO2like2, 192 Medicago_truncatula_MtAGO3, 193 Vitis_vinifera_VvAGO2like, 194 Nicotiana_attenuata_NaAGO2, 195 Solanum_lycopersicum_SlAGOlike1, 196 Solanum_lycopersicum_SlAGOlike2, 197 Solanum_lycopersicum_SlAGOlike3, 198 Brachypodium_distachyon_BdAGO2like, 199 Hordeum_vulgare_HvAGO3, 200 Oryza_sativa_OsAGO2, 201 Oryza_sativa_OsAGO3, 202 Tribolium_castaneum_TcAGO2b, 203 Tribolium_castaneum_TcAGO2a, 204 Nilaparvata_lugens_NlAGO2, 205 Aedes_aegypti_AaAGO2, 206 Anopheles_darlingi_AdAGO2, 207 Drosophila_immigrans_DiAGO2, 208 Drosophila_santomea_DsAGO2, 209 Drosophila_melanogaster_DmAGO2, 210 Bombyx_mori_BmoAGO2, 211 Spodoptera_litura_SplAGO2, 212 Arabidopsis_lyrata_AlAGO9, 213 Capsella_rubella_CrbAGO9, 214 Arabidopsis_thaliana_AtAGO9, 215 Brassica_rapa_BrAGO9a, 216 Thellungiella_halophila_ThAGO9, 217 Brassica_rapa_BrAGO9b, 218 Brassica_rapa_BrAGO9c, 219 Arabidopsis_lyrata_AlAGO8, 220 Arabidopsis_thaliana_AtAGO8, 221 Capsella_rubella_CrbAGO8, 222 Arabidopsis_lyrata_AlAGO4, 223 Capsella_rubella_CrbAGO4, 224 Arabidopsis_thaliana_AtAGO4, 225 Brassica_rapa_BrAGO4, 226 Thellungiella_halophila_ThAGO4, 227 Carica_papaya_CpAGO4, 228 Citrus_sinensis_CsnAGO4, 229 Manihot_esculenta_MeAGO4, 230 Ricinus_communis_RcAGO4a, 231 Eucalyptus_grandis_EgAGO4a, 232 Pelargonium_hortorum_PhAGO4like, 233 Vitis_vinifera_VvAGO4, 234 Cucumis_sativus_CstAGO4, 235 Prunus_persica_PprAGO4a, 236 Mimulus_guttatus_MgAGO4, 237 Nicotiana_attenuata_NaAGO4a, 238 Nicotiana_benthamiana_NbAGO4.1, 239 Nicotiana_attenuata_NaAGO4b, 240 Nicotiana_benthamiana_NbAGO4.2, 241 Solanum_lycopersicum_SlAGO4a, 242 Glycine_max_GmAGOlike2, 243 Phaseolus_vulgaris_PvAGO9, 244 Glycine_max_GmAGO4like, 245 Phaseolus_vulgaris_PvAGO4, 246 Medicago_truncatula_MtAGO4b, 247 Medicago_truncatula_MtAGO4c, 248 Eucalyptus_grandis_EgAGO4c, 249 Eucalyptus_grandis_EgAGO4b, 250 Solanum_lycopersicum_SlAGO4b, 251 Medicago_truncatula_MtAGO4d, 252 Linum_usitatissimum_LuAGO4b, 253 Linum_usitatissimum_LuAGO4a, 254 Medicago_truncatula_MtAGO4a, 255 Populus_trichocarpa_PtAGO4b, 256 Ricinus_communis_RcAGO4b, 257 Citrus_sinensis_CsnAGO9, 258 Malus_domestica_MdAGO4, 259 Prunus_persica_PprAGO4b, 260 Populus_trichocarpa_PtAGO4a, 261 Nicotiana_attenuata_NaAGO9, 262 Brachypodium_distachyon_BdAGO4Alike, 263 Oryza_sativa_OsAGO4A, 264 Zea_mays_ZmAGO4, 265 Oryza_sativa_OsAGO4B, 266 Sorghum_bicolor_SbAGO4, 267 Brachypodium_distachyon_BdAGO4Blike, 268 Mimulus_guttatus_MgAGO9, 269 Malus_domestica_MdAGO9, 270 Thellungiella_halophila_ThAGO8, 271 Vitis_vinifera_VvAGO4Alike, 272 Glycine_max_GmAGO4Blike, 273 Arabidopsis_lyrata_AlAGO6, 274 Arabidopsis_thaliana_AtAGO6, 275 Capsella_rubella_CrbAGO6, 276 Brassica_rapa_BrAGO6, 277 Thellungiella_halophila_ThAGO6, 278 Brachypodium_distachyon_BdAGO16like, 279 Citrus_sinensis_CsnAGO6, 280 Populus_trichocarpa_PtAGO6, 281 Vitis_vinifera_VvAGO16like, 282 Ricinus_communis_RcAGO6, 283 Nicotiana_attenuata_NaAGO8, 284 Linum_usitatissimum_LuAGO9, 285 Linum_usitatissimum_LuAGO6, 286 Mimulus_guttatus_MgAGO6, 287 Glycine_max_GmAGO16like, 288 Medicago_truncatula_MtAGO6, 289 Carica_papaya_CpAGO6, 290 Medicago_truncatula_MtAGO4e, 291 Picea_glauca_PgAGO, 292 Physcomitrella_patens_PptAGOlike1, 293 Physcomitrella_patens_PptAGOlike3, 294 Physcomitrella_patens_PptAGOlike2, 295 Chlamydomonas_reinhardtii_CrnAGO6, 296 Volvox_carteri_VcAGOlike, 297 Chlamydomonas_reinhardtii_CrnAGOlike, 298 Chlamydomonas_reinhardtii_CrnAGO2like, 299 Chlamydomonas_reinhardtii_CrnAGO2, 300 Kluyveromyces_polysporus_YeastAGO, 301 Tribolium_castaneum_TcAGO3, 302 Isodiametrica_pulchra_IpPIWIlike2; TREE All_AGOs_NJ = [&R] ((150:0.5350846199999999,((152:0.7982353600000001,(151:0.5165281500000001,((210:0.28247424,211:0.2124723799999999):0.6188933000000001,((204:0.31617721,(202:0.09451539999999992,203:0.06605810000000001):0.3357080800000001):0.06078760000000005,((205:0.2772298000000002,206:0.36497131000000005):0.33116535,(207:0.15236728999999993,(208:0.06747381000000008,209:0.05682785999999984):0.18885150000000017):0.44125119999999995):0.21766360000000007):0.04303019000000008):0.44295567000000013):0.038912069999999854):0.043916869999999886,(149:0.43809524,(148:0.15130869999999996,((142:0.016172140000000113,143:0.11894772999999992):0.08401776000000005,(147:0.1535755299999999,((144:0.1096280300000001,(140:0.026464290000000057,(139:0.00891343999999994,(137:0.0015640800000000787,(135:0.0013531300000000357,(136:0.002211420000000075,138:0.0014849500000000404):5.167100000000868E-4):2.8948999999989233E-4):0.005615530000000035):0.016691779999999934):0.08328091000000004):0.008731990000000023,((145:0.0472793199999999,146:0.0629889400000001):0.07704018000000001,(141:0.14494626999999993,((129:0.0039025599999999994,130:0.009170239999999996):0.006146020000000085,((127:0.0,(128:0.0,134:0.03279768000000005):0.002006619999999959):0.011328100000000063,(131:0.0013194499999999998,(132:0.00212838999999998,133:0.003458170000000038):5.435099999999693E-4):0.037993809999999906):0.0036176000000001096):0.06857573000000006):0.013791560000000036):0.024213089999999937):0.013706530000000106):0.020513970000000104):0.025285379999999913):0.1651695099999999):0.04706374999999996):0.03421715000000014):0.07623791000000003,(((300:2.07227728,((301:0.8162773699999999,302:0.93763146):1.8638933199999999,((298:0.019592030000000094,299:0.0):1.3414761599999998,(296:0.18304210999999992,(295:0.0,297:1.2161235100000003):0.16233809):0.45889661999999976):0.14726978000000024):0.11780938000000019):0.18517589,(((198:0.52531215,(199:0.1388218699999999,(200:0.10423391999999998,201:0.25685804):0.05409138000000002):0.044581259999999956):0.33037751999999987,((197:0.24488452000000005,(194:0.07704051,(195:0.09885704999999989,196:0.11719947000000008):0.030812360000000094):0.028529489999999935):0.1784107800000001,((193:0.21176166000000007,(188:0.24377647000000002,((189:0.08693320999999998,190:0.08796015000000001):0.12187439000000011,(191:0.0805083499999999,192:0.13298539999999992):0.04291665999999994):0.07415470999999996):0.005625659999999977):0.070527,(187:0.1926560799999999,((179:0.10326656999999995,180:0.08440336999999998):0.033453490000000086,(186:0.06382438000000001,(185:0.023778590000000044,(184:0.0559074799999999,(183:0.024967860000000064,(181:0.0,182:0.029358620000000002):0.01107013999999995):0.034757640000000034):0.016586800000000013):0.01134722999999993):0.06554002999999997):0.027822739999999957):0.23169138):0.03779244000000004):0.17553916999999997):0.28218056,((178:0.06289769999999995,(176:0.06709418,177:0.045842240000000034):0.015858630000000096):0.14726752999999992,(175:0.09774024000000003,((157:0.03045038,(156:0.02824008,(155:0.01246962000000007,(153:0.022175650000000102,154:0.0):0.0077363500000000585):0.02116782000000006):0.02549570000000001):0.11649686999999997,(173:0.09804698000000012,(174:0.09863492000000007,(172:0.10586760000000006,((170:0.03731218999999997,(169:0.02198130999999992,(168:0.03041136,171:0.04313649999999991):0.005794230000000011):0.005151399999999917):0.03955905999999998,((163:0.012128469999999947,(164:0.040208269999999935,167:0.015198969999999923):0.004376989999999914):0.044675690000000046,((161:0.024157360000000017,(159:0.029764209999999958,162:0.0454097):0.010963150000000033):0.007523240000000042,(160:0.0339457700000001,(158:0.039094890000000104,(165:0.05775828000000005,166:0.053411080000000055):0.005414510000000039):0.003617399999999993):0.006267440000000013):0.010710159999999913):0.011471110000000007):0.004856860000000074):0.012600640000000052):0.008109060000000001):0.006507599999999947):0.013343590000000072):0.025147760000000074):0.24878836999999998):0.17380847999999993):0.04842033999999984,(((294:0.2064327800000001,(292:0.1069517900000001,293:0.20070644999999998):0.0378910400000001):0.4076402699999999,(291:0.2411675499999999,((278:0.19855581999999994,(((276:0.027688350000000028,277:0.08240544999999999):0.00879995,(275:0.03557985999999991,(273:0.010982660000000033,274:0.033872829999999965):0.01716019999999996):0.01743395000000003):0.13627322000000008,(286:0.12787682,((287:0.11653621000000003,288:0.10156875999999992):0.07847991999999993,((284:0.11262568000000006,285:0.0864962600000001):0.06650026999999992,(283:0.13588800999999995,(281:0.06222257000000009,(279:0.06540612000000001,(289:0.22287053,(280:0.07097343999999994,282:0.12043629999999994):0.010622769999999893):0.016553189999999995):0.01427859999999992):0.017484349999999926):0.01288942999999998):0.01584165000000004):0.004121229999999976):0.01524052000000009):0.011759599999999981):0.07428688000000006,(((270:0.19313055,(221:0.10637786000000005,(219:0.03338156000000003,220:0.08828302999999993):0.024082970000000037):0.05883492999999995):0.03113794000000003,((213:0.015756990000000082,(212:0.009264649999999985,214:0.020809599999999984):0.005555659999999962):0.041175350000000055,(215:0.035978429999999895,(216:0.044987220000000105,(217:0.04699969000000004,218:0.07463117999999991):0.031637499999999985):0.009168309999999957):0.031184759999999923):0.03919165999999996):0.06262549000000006,(((264:0.08087410999999989,(262:0.048804569999999936,263:0.061625639999999926):0.019606849999999953):0.024995120000000037,(267:0.09734734,(265:0.043709210000000054,266:0.09733130000000001):0.01642144999999995):0.04047624000000005):0.05428097999999992,(((255:0.07380341000000001,256:0.06433858999999997):0.10697705999999996,((272:0.15623008000000005,290:0.22559354999999992):0.09427041999999997,(261:0.12932192999999992,(271:0.23648687000000002,(260:0.060135220000000045,((257:0.17788611,268:0.15222909000000007):0.007551950000000085,(269:0.15874582000000004,(258:0.04875290999999993,259:0.039548120000000075):0.056264340000000024):0.013129699999999911):0.02140802999999991):0.009509149999999966):0.008795979999999926):0.010254519999999934):0.02695362000000001):0.004576750000000018,(((225:0.03465085000000001,226:0.025703440000000022):0.020340440000000015,(224:0.005362270000000002,(222:0.0036041600000000784,223:0.014972580000000013):0.0095857800000001):0.018354910000000002):0.08809861000000008,(((242:0.03261969999999992,243:0.030369730000000095):0.04965237,((244:0.051035359999999974,245:0.03153199999999989):0.016700649999999984,(254:0.11616036000000007,(251:0.06446714000000009,(246:0.0,247:0.0011775700000000722):0.0373897700000001):0.022200149999999974):0.03771433999999996):0.029641079999999986):0.028797329999999954,(228:0.060274689999999964,(((252:0.0,253:0.020102040000000043):0.0700676899999999,((241:0.007069350000000085,(239:0.003454709999999972,240:0.007599640000000019):0.03512712000000007):0.018584570000000022,(236:0.08284529000000007,(250:0.08984057999999995,(237:0.0,238:0.017880099999999954):0.018385029999999913):0.02454449000000003):0.01965732000000009):0.012717120000000026):0.0075436799999999415,(233:0.04627982000000008,(227:0.048952529999999994,(229:0.05759742999999995,(235:0.03250539000000008,(231:0.031737459999999995,(234:0.045799389999999995,(232:0.039520119999999936,(230:0.06023873999999996,(248:5.0000000006989E-7,249:5.0000000006989E-7):0.08491050000000011):0.008198930000000049):0.009171830000000103):0.0026510200000000594):0.012466249999999901):0.009214300000000009):0.004304560000000013):0.006069569999999969):0.006158209999999942):0.008920040000000018):0.0023193100000000744):0.0073801399999999795):0.011566449999999895):0.011368180000000061):0.0291755199999999):0.05969901000000011):0.10110116999999996):0.24815688000000002):0.3045511999999999,((125:0.18529956999999997,126:0.3032311000000001):0.20701099000000012,((((122:0.23327078999999995,(120:0.14124285999999997,121:0.09150319000000007):0.036330830000000036):0.11609628999999999,((117:0.12617729999999994,118:0.15123813000000008):0.06886818999999988,((114:0.01709132999999996,115:0.02659664999999989):0.017953619999999892,(116:0.015150030000000037,124:0.07576413999999998):0.013234469999999998):0.08301185000000011):0.054018300000000075):0.0066950400000000965,((110:0.15534402999999997,119:0.2941166099999999):0.06576745000000006,((109:0.1731730199999999,111:0.15406743):0.030095339999999915,(112:0.21528773,(((98:0.0647644300000001,99:0.0):0.16723123000000006,(105:0.09639664999999997,(108:0.05894745000000001,(106:0.03311016000000011,107:0.03345793999999991):0.035259689999999955):0.08425480000000007):0.003202589999999894):0.006054060000000083,(((96:0.057395379999999996,97:0.06660657000000003):0.029063300000000014,(95:0.07235958000000009,(93:0.03619367000000007,94:0.023347189999999962):0.03031932000000004):0.03827720999999995):0.08745384,(113:0.21251338000000008,((103:0.04089889000000002,104:0.05308208000000003):0.0780234099999999,(102:0.08124506000000009,(100:0.04366844000000003,101:0.10485137999999994):0.018362320000000043):0.005915359999999925):0.019259509999999924):0.0068847700000000955):0.0059550399999999115):0.01253368999999993):0.014791049999999917):0.009700899999999901):0.014379219999999915):0.07856579000000008,(123:0.56182793,((((22:0.019027050000000045,(26:0.009751300000000018,(25:0.005504219999999949,(23:0.004355600000000015,24:0.0030645799999999834):0.002120340000000054):0.003583939999999952):0.004999710000000102):0.031807270000000054,(35:0.07910104000000007,(28:0.07693046000000003,((27:0.04821877000000008,(33:0.017169589999999957,34:0.024502900000000105):0.01932526999999995):0.01212794000000006,(32:0.11756860999999996,(31:0.025188720000000053,(29:0.007478279999999948,30:0.019037380000000104):0.010809000000000069):0.00870930999999997):0.024813430000000025):0.0013047399999999154):0.012484750000000044):0.060126279999999976):0.008124680000000106,((17:0.023526649999999982,21:0.035984489999999925):0.00472864999999989,((11:0.013753750000000009,(15:0.011657290000000042,16:0.0052153299999999625):0.00924861999999993):0.003546629999999995,(20:0.01706018000000009,((7:0.010739019999999933,(8:0.005855689999999969,9:0.007135609999999959):5.442099999999339E-4):0.0014904600000000823,(19:0.0389219999999999,(6:0.016835860000000036,((13:0.0036734800000000067,(14:6.216100000000502E-4,(12:0.0,18:0.009547179999999988):0.005512030000000001):0.0039222299999999155):0.011903430000000048,(10:0.012370729999999996,(4:0.00336233000000008,(5:0.007752760000000025,(3:0.002476099999999981,(1:0.0022774199999999745,2:0.0032916899999999583):0.002198780000000067):6.310199999999266E-4):8.305799999999142E-4):0.020319449999999906):0.002349310000000049):0.0011484799999998963):0.0020518599999999054):6.800000000000139E-4):0.0012842500000000978):0.002746460000000006):0.002805189999999902):0.025680329999999918):0.04288617000000006,(((86:0.04247344999999991,(87:0.0161308,88:0.016446930000000082):0.01111582000000011):0.045596210000000026,(92:0.13872908000000006,(89:0.0,90:0.005409949999999997):0.04124425000000009):0.028441230000000095):0.007182430000000073,((((80:0.01512289,(76:0.021176759999999906,(81:0.01202096000000008,82:0.0):0.008890110000000062):0.0024281900000000523):0.023961759999999943,(83:0.07723934999999993,(79:0.0258326499999999,(77:0.03297985999999997,78:0.024077490000000035):0.0025130799999999454):0.001229350000000018):0.023328900000000097):0.043738419999999945,(42:0.03888731999999995,(((51:0.014253709999999975,52:0.02063261999999999):0.016676949999999913,(44:0.0,(43:0.004937170000000046,48:0.017566369999999942):0.0020586400000000005):0.004306219999999916):6.66529999999943E-4,(50:0.025793799999999978,(47:0.006642849999999978,(45:4.6503999999991663E-4,(46:0.001522660000000009,49:0.03831994999999999):0.0013450699999999483):0.005985920000000089):0.00302431000000003):0.0016917000000000737):0.0032745199999999475):0.017382100000000067):0.0023532500000000844,(91:0.13103185000000006,(((84:0.010996570000000094,85:0.006383320000000081):0.04058778000000007,((40:0.008392579999999983,41:0.014555300000000049):0.0028120000000000367,((36:0.005150100000000046,37:0.006076870000000012):0.002948890000000093,(38:5.0000000006989E-7,39:5.0000000006989E-7):0.015379360000000064):0.009577989999999925):0.03611359999999997):0.0018672799999999157,((75:0.020899669999999926,(73:0.005375270000000043,74:0.0021193500000000753):0.03576818000000004):0.010682679999999944,(((53:0.01823174999999999,(60:0.026008250000000066,(54:0.006154079999999951,55:0.016582000000000097):0.0022344800000000387):4.234700000000924E-4):0.0022342600000000434,((61:0.025704240000000045,64:0.02198140000000004):0.0017783600000000899,(62:0.0,63:0.07262441999999991):0.009429010000000071):0.0018023199999999129):0.0010973000000000788,(((58:0.004302639999999913,59:0.0031551599999999347):0.007987669999999891,(71:0.03962263999999993,72:0.03149445000000006):0.007389040000000069):0.0066385799999999495,((56:0.014368610000000004,57:0.004479710000000026):0.014067810000000014,(70:0.03128540999999996,((68:0.0,69:0.0037223600000000356):0.016400809999999932,(66:0.004629149999999971,(65:0.0026125500000000468,67:0.0010836000000000734):9.627100000000333E-4):0.017406309999999925):0.002545189999999975):0.005059680000000011):8.542000000000272E-4):0.0013996599999999138):0.0036970100000000006):0.005345539999999982):0.0037057199999999124):0.004812040000000017):0.008134139999999901):0.01316373000000004):0.019801229999999892):0.07638977000000002):0.06224161000000006):0.15701942999999985):0.05416449000000001):0.07623791); END; BEGIN TREES; TITLE 'Plant AGOs - NJ'; LINK TAXA = Taxa2; TRANSLATE 1 Arabidopsis_lyrata_AlAGO10, 2 Arabidopsis_thaliana_AtAGO10, 3 Capsella_rubella_CrbAGO10, 4 Thellungiella_halophila_ThAGO10, 5 Brassica_rapa_BrAGO10, 6 Carica_papaya_CpAGO10, 7 Citrus_sinensis_CsnAGO10, 8 Manihot_esculenta_MeAGO10, 9 Ricinus_communis_RcAGO10a, 10 Populus_trichocarpa_PtAGO10, 11 Vitis_vinifera_VvAGO10like, 12 Malus_domestica_MdAGO10a, 13 Prunus_persica_PprAGO10, 14 Malus_domestica_MdAGO10b, 15 Glycine_max_GmAGO10like, 16 Phaseolus_vulgaris_PvAGO10a, 17 Nicotiana_attenuata_NaAGO10, 18 Malus_domestica_MdAGO1b, 19 Linum_usitatissimum_LuAGO10a, 20 Eucalyptus_grandis_EgAGO10a, 21 Mimulus_guttatus_MgAGO10, 22 Brachypodium_distachyon_BdPNH1like, 23 Sorghum_bicolor_SbAGO10a, 24 Zea_mays_ZmAGO10a, 25 Zea_mays_ZmAGO10b, 26 Oryza_sativa_OsPNH1, 27 Carica_papaya_CpAGO1, 28 Cucumis_sativus_CstAGO1b, 29 Glycine_max_GmPNH1like1, 30 Phaseolus_vulgaris_PvAGO10b, 31 Glycine_max_GmPNH1like2, 32 Medicago_truncatula_MtAGO10, 33 Manihot_esculenta_MeAGO1, 34 Ricinus_communis_RcAGO10b, 35 Vitis_vinifera_VvPNH1, 36 Arabidopsis_lyrata_AlAGO1, 37 Capsella_rubella_CrbAGO1, 38 Arabidopsis_thaliana_AtAGOlike, 39 Arabidopsis_thaliana_AtAGO1, 40 Thellungiella_halophila_ThAGO1, 41 Brassica_rapa_BrAGO1, 42 Brachypodium_distachyon_BdAGO1Alike, 43 Brachypodium_distachyon_BdAGO1Blike, 44 Hordeum_vulgare_HvAGO1a, 45 Sorghum_bicolor_SbAGO10b, 46 Zea_mays_ZmAGO1a, 47 Oryza_sativa_OsAGO1B, 48 Hordeum_vulgare_HvAGO10, 49 Zea_mays_ZmAGO1c, 50 Oryza_sativa_OsAGO1A, 51 Sorghum_bicolor_SbAGO10c, 52 Zea_mays_ZmAGO1b, 53 Citrus_sinensis_CsnAGO1, 54 Ricinus_communis_RcAGO1, 55 Populus_trichocarpa_PtAGO1, 56 Malus_domestica_MdAGO1a, 57 Prunus_persica_PprAGO1a, 58 Glycine_max_GmAGOlike1, 59 Phaseolus_vulgaris_PvAGO1, 60 Cucumis_sativus_CstAGO1a, 61 Eucalyptus_grandis_EgAGO1, 62 Vitis_vinifera_VvAGO1like, 63 Vitis_vinifera_VvAGO1Blike, 64 Mimulus_guttatus_MgAGO1, 65 Nicotiana_attenuata_NaAGO1a, 66 Nicotiana_benthamiana_NbAGO1.1, 67 Nicotiana_tabacum_NtAGO1, 68 Nicotiana_attenuata_NaAGO1b, 69 Nicotiana_benthamiana_NbAGO1.2, 70 Nicotiana_attenuata_NaAGO1c, 71 Pisum_sativum_PsAGO2, 72 Pisum_sativum_PsAGO1, 73 Linum_usitatissimum_LuAGO1, 74 Linum_usitatissimum_LuAGO5, 75 Linum_usitatissimum_LuAGO10b, 76 Brachypodium_distachyon_BdAGO1Dlike, 77 Hordeum_vulgare_HvAGO1b, 78 Oryza_sativa_OsAGO1C, 79 Sorghum_bicolor_SbAGO1a, 80 Oryza_sativa_OsAGO1D, 81 Zea_mays_ZmAGO1d, 82 Sorghum_bicolor_SbAGO1b, 83 Brachypodium_distachyon_BdAGO1Clike, 84 Malus_domestica_MdAGO10c, 85 Prunus_persica_PprAGO1b, 86 Physcomitrella_patens_PptAGO5, 87 Physcomitrella_patens_PptAGO1, 88 Physcomitrella_patens_PptAGO10, 89 Selaginella_moellendorfii_SmAGO10, 90 Selaginella_moellendorfii_SmAGO1a, 91 Eucalyptus_grandis_EgAGO10b, 92 Selaginella_moellendorfii_SmAGO1b, 93 Arabidopsis_lyrata_AlAGO5, 94 Arabidopsis_thaliana_AtAGO5, 95 Capsella_rubella_CrbAGO5, 96 Brassica_rapa_BrAGO5, 97 Thellungiella_halophila_ThAGO5, 98 Citrus_sinensis_CsnAGO5, 99 Citrus_sinensis_CsnAGOlike, 100 Manihot_esculenta_MeAGO5, 101 Manihot_esculenta_MeAGOlike, 102 Ricinus_communis_RcAGO5, 103 Populus_trichocarpa_PtAGOlike2, 104 Populus_trichocarpa_PtAGOlike3, 105 Vitis_vinifera_VvAGO5like, 106 Malus_domestica_MdAGO5b, 107 Malus_domestica_MdAGO5a, 108 Prunus_persica_PprAGO5, 109 Nicotiana_attenuata_NaAGO5, 110 Populus_trichocarpa_PtAGOlike1, 111 Mimulus_guttatus_MgAGO5, 112 Glycine_max_GmAGO5like2, 113 Carica_papaya_CpAGO5, 114 Brachypodium_distachyon_BdMEL1like, 115 Hordeum_vulgare_HvAGO5, 116 Oryza_sativa_OsMLE1, 117 Brachypodium_distachyon_BdMELlike, 118 Oryza_sativa_OsAGO14, 119 Vitis_vinifera_VvMEL1like, 120 Brachypodium_distachyon_BdAGO12like, 121 Oryza_sativa_OsAGO12, 122 Oryza_sativa_OsAGO11, 123 Oryza_sativa_OsAGO17, 124 Oryza_sativa_OsAGO13, 125 Brachypodium_distachyon_BdAGO18like, 126 Oryza_sativa_OsAGO18, 127 Tribolium_castaneum_TcAGO1b, 128 Tribolium_castaneum_TcAGO1a, 129 Homo_sapiens_HsAGO2, 130 Arabidopsis_lyrata_AlAGO7, 131 Arabidopsis_thaliana_AtAGO7, 132 Capsella_rubella_CrbAGO7, 133 Thellungiella_halophila_ThAGO7, 134 Brassica_rapa_BrAGO7, 135 Carica_papaya_CpAGO7, 136 Manihot_esculenta_MeAGO7b, 137 Populus_trichocarpa_PtAGO7, 138 Ricinus_communis_RcAGO7, 139 Manihot_esculenta_MeAGO7a, 140 Malus_domestica_MdAGO7b, 141 Prunus_persica_PprAGO7, 142 Vitis_vinifera_VvAGO7like, 143 Citrus_sinensis_CsnAGO7, 144 Malus_domestica_MdAGO7a, 145 Glycine_max_GmAGO7like, 146 Phaseolus_vulgaris_PvAGO7, 147 Lotus_japonicus_LjAGO7, 148 Medicago_truncatula_MtAGO7, 149 Nicotiana_attenuata_NaAGO7, 150 Eucalyptus_grandis_EgAGO7, 151 Linum_usitatissimum_LuAGO7, 152 Mimulus_guttatus_MgAGO7, 153 Brachypodium_distachyon_BdAGO7like, 154 Oryza_sativa_OsSHL4, 155 Sorghum_bicolor_SbAGO7, 156 Arabidopsis_lyrata_AlAGO3, 157 Arabidopsis_thaliana_AtAGO3, 158 Arabidopsis_lyrata_AlAGO2, 159 Arabidopsis_thaliana_AtAGO2, 160 Capsella_rubella_CrbAGO2, 161 Thellungiella_halophila_ThAGO2, 162 Brassica_rapa_BrAGO2a, 163 Brassica_rapa_BrAGO2b, 164 Capsella_rubella_CrbAGO3, 165 Carica_papaya_CpAGO2, 166 Glycine_max_GmAGO2like1, 167 Medicago_truncatula_MtAGO2, 168 Glycine_max_GmAGO2like2, 169 Medicago_truncatula_MtAGO3, 170 Vitis_vinifera_VvAGO2like, 171 Nicotiana_attenuata_NaAGO2, 172 Solanum_lycopersicum_SlAGOlike1, 173 Solanum_lycopersicum_SlAGOlike2, 174 Solanum_lycopersicum_SlAGOlike3, 175 Brachypodium_distachyon_BdAGO2like, 176 Hordeum_vulgare_HvAGO3, 177 Oryza_sativa_OsAGO2, 178 Oryza_sativa_OsAGO3, 179 Tribolium_castaneum_TcAGO2b, 180 Tribolium_castaneum_TcAGO2a, 181 Arabidopsis_lyrata_AlAGO9, 182 Capsella_rubella_CrbAGO9, 183 Arabidopsis_thaliana_AtAGO9, 184 Brassica_rapa_BrAGO9a, 185 Thellungiella_halophila_ThAGO9, 186 Brassica_rapa_BrAGO9b, 187 Brassica_rapa_BrAGO9c, 188 Arabidopsis_lyrata_AlAGO8, 189 Arabidopsis_thaliana_AtAGO8, 190 Capsella_rubella_CrbAGO8, 191 Arabidopsis_lyrata_AlAGO4, 192 Capsella_rubella_CrbAGO4, 193 Arabidopsis_thaliana_AtAGO4, 194 Brassica_rapa_BrAGO4, 195 Thellungiella_halophila_ThAGO4, 196 Carica_papaya_CpAGO4, 197 Citrus_sinensis_CsnAGO4, 198 Manihot_esculenta_MeAGO4, 199 Ricinus_communis_RcAGO4a, 200 Eucalyptus_grandis_EgAGO4a, 201 Pelargonium_hortorum_PhAGO4like, 202 Vitis_vinifera_VvAGO4, 203 Cucumis_sativus_CstAGO4, 204 Prunus_persica_PprAGO4a, 205 Mimulus_guttatus_MgAGO4, 206 Nicotiana_attenuata_NaAGO4a, 207 Nicotiana_benthamiana_NbAGO4.1, 208 Nicotiana_attenuata_NaAGO4b, 209 Nicotiana_benthamiana_NbAGO4.2, 210 Solanum_lycopersicum_SlAGO4a, 211 Glycine_max_GmAGOlike2, 212 Phaseolus_vulgaris_PvAGO9, 213 Glycine_max_GmAGO4like, 214 Phaseolus_vulgaris_PvAGO4, 215 Medicago_truncatula_MtAGO4b, 216 Medicago_truncatula_MtAGO4c, 217 Eucalyptus_grandis_EgAGO4c, 218 Eucalyptus_grandis_EgAGO4b, 219 Solanum_lycopersicum_SlAGO4b, 220 Medicago_truncatula_MtAGO4d, 221 Linum_usitatissimum_LuAGO4b, 222 Linum_usitatissimum_LuAGO4a, 223 Medicago_truncatula_MtAGO4a, 224 Populus_trichocarpa_PtAGO4b, 225 Ricinus_communis_RcAGO4b, 226 Citrus_sinensis_CsnAGO9, 227 Malus_domestica_MdAGO4, 228 Prunus_persica_PprAGO4b, 229 Populus_trichocarpa_PtAGO4a, 230 Nicotiana_attenuata_NaAGO9, 231 Brachypodium_distachyon_BdAGO4Alike, 232 Oryza_sativa_OsAGO4A, 233 Zea_mays_ZmAGO4, 234 Oryza_sativa_OsAGO4B, 235 Sorghum_bicolor_SbAGO4, 236 Brachypodium_distachyon_BdAGO4Blike, 237 Mimulus_guttatus_MgAGO9, 238 Malus_domestica_MdAGO9, 239 Thellungiella_halophila_ThAGO8, 240 Vitis_vinifera_VvAGO4Alike, 241 Glycine_max_GmAGO4Blike, 242 Arabidopsis_lyrata_AlAGO6, 243 Arabidopsis_thaliana_AtAGO6, 244 Capsella_rubella_CrbAGO6, 245 Brassica_rapa_BrAGO6, 246 Thellungiella_halophila_ThAGO6, 247 Brachypodium_distachyon_BdAGO16like, 248 Citrus_sinensis_CsnAGO6, 249 Populus_trichocarpa_PtAGO6, 250 Vitis_vinifera_VvAGO16like, 251 Ricinus_communis_RcAGO6, 252 Nicotiana_attenuata_NaAGO8, 253 Linum_usitatissimum_LuAGO9, 254 Linum_usitatissimum_LuAGO6, 255 Mimulus_guttatus_MgAGO6, 256 Glycine_max_GmAGO16like, 257 Medicago_truncatula_MtAGO6, 258 Carica_papaya_CpAGO6, 259 Medicago_truncatula_MtAGO4e, 260 Picea_glauca_PgAGO, 261 Physcomitrella_patens_PptAGOlike1, 262 Physcomitrella_patens_PptAGOlike3, 263 Physcomitrella_patens_PptAGOlike2, 264 Chlamydomonas_reinhardtii_CrnAGO6, 265 Volvox_carteri_VcAGOlike, 266 Chlamydomonas_reinhardtii_CrnAGOlike, 267 Chlamydomonas_reinhardtii_CrnAGO2like, 268 Chlamydomonas_reinhardtii_CrnAGO2, 269 Kluyveromyces_polysporus_YeastAGO, 270 Tribolium_castaneum_TcAGO3; TREE Plant_AGOs_NJ = [&R] (270:2.52301987,(((267:0.01606249,268:-3.643E-4)1.0000:1.44299173,(265:0.2051676,(264:-0.04914057,266:1.22145423)0.9400:0.17402406)1.0000:0.49795862)0.8300:0.16305268,(269:2.1121442,(((179:0.10677697,180:0.06335071)1.0000:0.9278029,(129:0.12223972,(127:5.0E-7,128:5.0E-7)1.0000:0.1283904)1.0000:0.31861059)0.7300:0.15362981,((((175:0.6071549,(176:0.15183908,(177:0.11152609,178:0.28334313)0.7200:0.05422049)0.6100:0.03221225)1.0000:0.3595554,((164:0.25368311,(157:0.10256862,(156:0.11652887,(162:0.03381169,(163:0.07241208,(161:0.05323418,(160:0.02337024,(158:-3.8481E-4,159:0.0310753)0.8800:0.01680448)0.9400:0.03546742)0.5600:0.01291392)0.4200:0.00553563)1.0000:0.077625)0.3000:0.02051038)0.3300:0.02365677)1.0000:0.27653017,((174:0.24518225,(173:0.13469528,(171:0.07420559,172:0.094438)0.5500:0.0260706)0.7400:0.0293874)1.0000:0.17665189,((165:0.2608058,170:0.21243113)0.5200:0.02430518,(168:0.10008057,(169:0.15952842,(166:0.089177,167:0.09429032)1.0000:0.13184046)0.5800:0.02168141)0.9600:0.10700273)0.9400:0.06365586)0.7000:0.0476849)1.0000:0.16818603)1.0000:0.35766196,((154:0.05022165,(153:0.07930477,155:0.05969413)0.5900:0.01424197)1.0000:0.15824017,(152:0.09314139,((134:0.02921456,(133:0.03424964,(131:0.0036728,(130:0.02493306,132:0.02121163)0.4300:0.00565395)0.8800:0.02080504)0.9800:0.02548285)1.0000:0.12279048,(150:0.10045571,(151:0.08600875,((149:0.10075387,(147:0.03252554,(148:0.04228282,(145:0.03442356,146:0.01300341)0.5700:0.01160192)0.3500:0.00378029)1.0000:0.04533522)0.2800:0.00909656,((138:0.02941644,(136:0.03325048,139:0.04792504)0.7100:0.00758155)0.5500:0.00951991,((144:0.0104414,(140:0.01476042,141:0.04058526)0.8800:0.01198442)0.9700:0.04311056,((135:0.04563638,137:0.03876897)0.1800:0.00181738,(142:0.06419419,143:0.06095068)0.3200:0.00632588)0.2400:0.01037106)0.2400:0.01005571)0.2000:0.00510113)0.6200:0.02291319)0.3700:0.01427996)0.4900:0.01747723)0.5300:0.01491884)0.7100:0.03546975)1.0000:0.2365152)0.9800:0.2526458,(((263:0.21838302,(261:0.11433672,262:0.18079455)0.9500:0.04983486)1.0000:0.41220816,(260:0.25444475,((247:0.23032758,(((253:0.12442531,254:0.09914722)0.9800:0.09218656,(245:0.03827632,(246:0.09566291,(244:0.04086283,(242:0.01395039,243:0.03182536)0.9100:0.01657137)0.8600:0.01614591)0.5800:0.01027179)1.0000:0.15768008)0.1100:0.00566854,((256:0.12602652,257:0.10772643)0.9900:0.07761092,(255:0.12641802,(252:0.14588714,(250:0.06385668,(248:0.06188812,(258:0.20954731,(249:0.07503323,251:0.11240698)0.5000:0.0136968)0.4000:0.01606255)0.4600:0.0225826)0.2200:0.01344372)0.1100:0.01174595)0.1000:0.00858733)0.1400:0.01397787)0.2600:0.0086672)1.0000:0.07997957,(((239:0.21042487,(190:0.11538249,(188:0.03018355,189:0.08558289)0.7300:0.01699388)0.9600:0.05233837)0.9500:0.04172261,((182:0.01961802,(181:0.01344307,183:0.01806707)0.5300:0.00385479)1.0000:0.04084628,((184:0.04156726,185:0.05103383)0.6300:0.00865488,(186:0.04787956,187:0.08383108)0.9900:0.03597474)0.9300:0.02931655)0.8900:0.03575944)1.0000:0.07441465,(((233:0.07715056,(231:0.04571227,232:0.06814419)0.7000:0.0175727)0.9400:0.03027769,(236:0.0996617,(234:0.04667979,235:0.09379014)0.9000:0.02523225)0.9700:0.04016117)1.0000:0.06014428,(((194:0.03040937,195:0.02983212)0.9600:0.02967194,(193:0.00517463,(191:0.00466426,192:0.01609753)0.9600:0.0122233)0.8200:0.01854915)1.0000:0.10376294,((230:0.14064325,((241:0.17547993,259:0.2489484)0.9900:0.09585682,(229:0.07915486,((237:0.16710921,240:0.24782466)0.1600:0.01046996,(238:0.17447131,(226:0.19051077,(227:0.06215453,228:0.04028881)1.0000:0.05817627)0.1900:0.00871411)0.2300:0.0165115)0.0900:0.00396175)0.1800:0.00892453)0.2900:0.01771274)0.5800:0.01892813,((224:0.08497061,225:0.06331591)1.0000:0.10355243,((197:0.06032044,((211:0.03271522,212:0.04138647)1.0000:0.04230896,((213:0.05710334,214:0.03520269)0.4600:0.0136024,(223:0.12193653,(220:0.06602827,(215:-0.0018694,216:0.0018704)1.0000:0.03676587)0.8100:0.01688268)0.9700:0.04211646)0.9300:0.03569443)0.6100:0.02457284)0.1100:0.00549407,(196:0.06241844,(202:0.0518306,(204:0.0464826,(200:0.05235204,((205:0.08290853,((219:0.10496157,(206:-0.00493903,207:0.02038416)0.9100:0.02047245)0.9100:0.02322473,(210:0.03795486,(208:0.00356074,209:0.00499009)0.8800:0.01333784)0.9300:0.03306399)0.4500:0.00212779)0.6600:0.01458882,((221:0.00928341,222:0.01061564)1.0000:0.07577602,(198:0.04878388,(203:0.05560494,(201:0.05101757,(199:0.05726004,(217:5.0E-7,218:5.0E-7)1.0000:0.09574544)0.3800:0.00919566)0.1700:0.0058449)0.0900:0.00997545)0.1000:0.00441925)0.0900:0.00683219)0.0400:0.01121099)0.0800:0.00209122)0.0200:0.00344341)0.0900:0.00485386)0.1200:0.00621891)0.3100:0.00912305)0.2700:0.01479598)0.1600:0.00637684)0.3600:0.02065026)0.6000:0.02079288)0.9600:0.04245483)0.9900:0.11069549)1.0000:0.28117265)0.9800:0.32982563,((125:0.18962549,126:0.32722777)1.0000:0.2229219,((((122:0.23420997,(120:0.17230741,121:0.10075888)0.9800:0.04037293)1.0000:0.12096392,((117:0.12650136,118:0.16496207)1.0000:0.078337,(124:0.10262147,(116:0.0184298,(114:0.01674477,115:0.02816904)0.9500:0.01100445)0.5200:0.01136108)1.0000:0.08838208)1.0000:0.0579726)0.6200:0.00852272,((110:0.16118351,119:0.32521465)1.0000:0.07050197,((109:0.17931152,111:0.15799862)0.8900:0.03057843,((113:0.23477263,((96:0.04881684,97:0.07209455)0.9700:0.03122812,(95:0.08192601,(93:0.03191504,94:0.02953818)1.0000:0.03232909)1.0000:0.03627828)1.0000:0.08299502)0.5200:0.01620547,(112:0.22651224,((108:0.0695286,(106:0.0343484,107:0.03390385)0.9900:0.04678299)0.9900:0.07343402,(105:0.10097899,((98:0.06773518,99:-0.00603716)1.0000:0.16490937,((103:0.05217942,104:0.05514034)1.0000:0.07760667,(102:0.07456152,(100:0.03800355,101:0.11159777)0.8200:0.02076512)0.6400:0.00655102)0.8200:0.01633315)0.4000:0.0067204)0.2400:0.00253784)0.2000:0.00555955)0.2600:0.00813731)0.5200:0.01174947)0.6600:0.010742)0.7200:0.0218205)0.9700:0.07524596,(123:0.56941837,((((22:0.02228518,(26:0.01155935,(24:0.00766599,(23:0.00431287,25:0.00632462)0.6200:0.00296886)0.9400:0.00782259)0.6200:0.00508782)1.0000:0.0313722,(35:0.08177508,((28:0.08033528,(27:0.04786717,(33:0.02082079,34:0.02766005)1.0000:0.02406246)0.6600:0.00638351)0.6000:0.00431705,(32:0.12447259,(31:0.02997345,(29:0.00778091,30:0.02265856)1.0000:0.01354301)0.5400:0.01055801)1.0000:0.02536967)0.8400:0.00930678)1.0000:0.06656176)0.9300:0.01341408,(11:0.01747829,((17:0.02608813,21:0.03767118)0.3600:0.00628208,(20:0.01799769,(((15:0.01226343,16:0.00892347)0.8500:0.00925668,(19:0.03852745,((4:0.00205369,5:0.00494485)0.5700:0.00200702,(3:0.00351097,(1:0.00250308,2:0.00449139)0.6300:0.00266162)0.3900:0.00111055)1.0000:0.02248059)0.4000:0.00621986)0.0000:5.9935E-4,(7:0.01108456,(9:0.00989078,((8:0.00418819,10:0.01694263)0.2000:9.7591E-4,(6:0.01922584,(13:0.00482147,(14:-6.7826E-4,(12:-0.00344602,18:0.01873959)1.0000:0.00677494)0.8200:0.0059738)0.9100:0.007451)0.1900:0.00162618)0.0400:8.7566E-4)0.0100:0.0011773)0.0600:0.00232549)0.1400:0.002768)0.1100:0.00239914)0.1700:0.00107774)1.0000:0.02582925)1.0000:0.05344306,(((86:0.04520838,(87:0.01548441,88:0.01506243)1.0000:0.01921211)1.0000:0.04516244,(92:0.15615215,(89:-0.00271618,90:0.00642794)1.0000:0.05883625)0.8900:0.02491357)0.7000:0.00844174,((((76:0.02404164,(80:0.01204719,(81:0.01378548,82:9.6549E-4)0.9400:0.01060617)0.7800:0.00515304)1.0000:0.0237998,(79:0.02979087,(83:0.09033282,(77:0.03153895,78:0.02584854)0.6200:0.00502833)0.3200:0.00216803)1.0000:0.01890258)1.0000:0.04581004,((42:0.04345821,50:0.02801267)0.3800:0.00373747,((51:0.01723057,52:0.02111662)0.9300:0.01835419,((44:-0.00175403,(43:0.00660713,48:0.02541837)0.5200:0.00161418)0.5200:0.00429966,(47:0.00831788,(46:0.00376897,(45:0.00105357,49:0.0386456)0.4500:0.00137735)0.9700:0.00594197)0.5600:0.0041385)0.2100:2.9691E-4)0.3100:0.00391032)0.5700:0.01517334)0.3100:0.00561459,((84:0.01321781,85:0.0086571)1.0000:0.04247982,(91:0.1377176,(((40:0.00752338,41:0.01217588)0.9000:0.0054032,((36:0.00673098,37:0.00555722)0.6800:0.00217672,(38:5.0E-7,39:5.0E-7)1.0000:0.01499781)0.9800:0.00743815)1.0000:0.0404776,((75:0.02426813,(73:0.00646118,74:0.00233008)1.0000:0.03454669)0.9400:0.01369272,(61:0.02846322,(((53:0.01822496,(62:-5.8784E-4,63:0.07318462)0.9000:0.00998975)0.2000:0.00152659,(60:0.02985855,(54:0.00659223,55:0.02408741)0.5400:0.00169528)0.2500:0.00200508)0.1800:0.00220265,(((56:0.01196282,57:0.00394605)1.0000:0.01680621,((58:0.00481386,59:0.00572117)0.9200:0.00962255,(71:0.04488467,72:0.04257551)0.4300:0.00580771)0.4700:0.0066527)0.0800:4.4608E-4,(64:0.02543146,((68:-1.4699E-4,69:0.0036335)1.0000:0.01956836,(70:0.03285268,(66:0.00410842,(65:0.00245691,67:0.00101524)0.6500:0.00112834)1.0000:0.01554733)0.5400:0.00200404)0.7700:0.0071745)0.2400:0.00331511)0.1100:0.00114351)0.1600:9.4328E-4)0.4300:0.00562912)0.1600:0.00144489)0.5700:0.00352988)0.4300:0.00544065)0.3100:0.00354916)0.2300:0.00553684)0.2600:0.01482163)0.4100:0.01686025)0.9900:0.09549689)0.9500:0.07433084)0.9500:0.13507226)0.3800:0.0249345)0.5700:0.08960227)0.4900:0.11955955)0.5900:0.21171382)0.0000:0.19916184); END; BEGIN TREES; TITLE 'Plant AGOs - ML'; LINK TAXA = Taxa2; TRANSLATE 1 Arabidopsis_lyrata_AlAGO10, 2 Arabidopsis_thaliana_AtAGO10, 3 Capsella_rubella_CrbAGO10, 4 Thellungiella_halophila_ThAGO10, 5 Brassica_rapa_BrAGO10, 6 Carica_papaya_CpAGO10, 7 Citrus_sinensis_CsnAGO10, 8 Manihot_esculenta_MeAGO10, 9 Ricinus_communis_RcAGO10a, 10 Populus_trichocarpa_PtAGO10, 11 Vitis_vinifera_VvAGO10like, 12 Malus_domestica_MdAGO10a, 13 Prunus_persica_PprAGO10, 14 Malus_domestica_MdAGO10b, 15 Glycine_max_GmAGO10like, 16 Phaseolus_vulgaris_PvAGO10a, 17 Nicotiana_attenuata_NaAGO10, 18 Malus_domestica_MdAGO1b, 19 Linum_usitatissimum_LuAGO10a, 20 Eucalyptus_grandis_EgAGO10a, 21 Mimulus_guttatus_MgAGO10, 22 Brachypodium_distachyon_BdPNH1like, 23 Sorghum_bicolor_SbAGO10a, 24 Zea_mays_ZmAGO10a, 25 Zea_mays_ZmAGO10b, 26 Oryza_sativa_OsPNH1, 27 Carica_papaya_CpAGO1, 28 Cucumis_sativus_CstAGO1b, 29 Glycine_max_GmPNH1like1, 30 Phaseolus_vulgaris_PvAGO10b, 31 Glycine_max_GmPNH1like2, 32 Medicago_truncatula_MtAGO10, 33 Manihot_esculenta_MeAGO1, 34 Ricinus_communis_RcAGO10b, 35 Vitis_vinifera_VvPNH1, 36 Arabidopsis_lyrata_AlAGO1, 37 Capsella_rubella_CrbAGO1, 38 Arabidopsis_thaliana_AtAGOlike, 39 Arabidopsis_thaliana_AtAGO1, 40 Thellungiella_halophila_ThAGO1, 41 Brassica_rapa_BrAGO1, 42 Brachypodium_distachyon_BdAGO1Alike, 43 Brachypodium_distachyon_BdAGO1Blike, 44 Hordeum_vulgare_HvAGO1a, 45 Sorghum_bicolor_SbAGO10b, 46 Zea_mays_ZmAGO1a, 47 Oryza_sativa_OsAGO1B, 48 Hordeum_vulgare_HvAGO10, 49 Zea_mays_ZmAGO1c, 50 Oryza_sativa_OsAGO1A, 51 Sorghum_bicolor_SbAGO10c, 52 Zea_mays_ZmAGO1b, 53 Citrus_sinensis_CsnAGO1, 54 Ricinus_communis_RcAGO1, 55 Populus_trichocarpa_PtAGO1, 56 Malus_domestica_MdAGO1a, 57 Prunus_persica_PprAGO1a, 58 Glycine_max_GmAGOlike1, 59 Phaseolus_vulgaris_PvAGO1, 60 Cucumis_sativus_CstAGO1a, 61 Eucalyptus_grandis_EgAGO1, 62 Vitis_vinifera_VvAGO1like, 63 Vitis_vinifera_VvAGO1Blike, 64 Mimulus_guttatus_MgAGO1, 65 Nicotiana_attenuata_NaAGO1a, 66 Nicotiana_benthamiana_NbAGO1.1, 67 Nicotiana_tabacum_NtAGO1, 68 Nicotiana_attenuata_NaAGO1b, 69 Nicotiana_benthamiana_NbAGO1.2, 70 Nicotiana_attenuata_NaAGO1c, 71 Pisum_sativum_PsAGO2, 72 Pisum_sativum_PsAGO1, 73 Linum_usitatissimum_LuAGO1, 74 Linum_usitatissimum_LuAGO5, 75 Linum_usitatissimum_LuAGO10b, 76 Brachypodium_distachyon_BdAGO1Dlike, 77 Hordeum_vulgare_HvAGO1b, 78 Oryza_sativa_OsAGO1C, 79 Sorghum_bicolor_SbAGO1a, 80 Oryza_sativa_OsAGO1D, 81 Zea_mays_ZmAGO1d, 82 Sorghum_bicolor_SbAGO1b, 83 Brachypodium_distachyon_BdAGO1Clike, 84 Malus_domestica_MdAGO10c, 85 Prunus_persica_PprAGO1b, 86 Physcomitrella_patens_PptAGO5, 87 Physcomitrella_patens_PptAGO1, 88 Physcomitrella_patens_PptAGO10, 89 Selaginella_moellendorfii_SmAGO10, 90 Selaginella_moellendorfii_SmAGO1a, 91 Eucalyptus_grandis_EgAGO10b, 92 Selaginella_moellendorfii_SmAGO1b, 93 Arabidopsis_lyrata_AlAGO5, 94 Arabidopsis_thaliana_AtAGO5, 95 Capsella_rubella_CrbAGO5, 96 Brassica_rapa_BrAGO5, 97 Thellungiella_halophila_ThAGO5, 98 Citrus_sinensis_CsnAGO5, 99 Citrus_sinensis_CsnAGOlike, 100 Manihot_esculenta_MeAGO5, 101 Manihot_esculenta_MeAGOlike, 102 Ricinus_communis_RcAGO5, 103 Populus_trichocarpa_PtAGOlike2, 104 Populus_trichocarpa_PtAGOlike3, 105 Vitis_vinifera_VvAGO5like, 106 Malus_domestica_MdAGO5b, 107 Malus_domestica_MdAGO5a, 108 Prunus_persica_PprAGO5, 109 Nicotiana_attenuata_NaAGO5, 110 Populus_trichocarpa_PtAGOlike1, 111 Mimulus_guttatus_MgAGO5, 112 Glycine_max_GmAGO5like2, 113 Carica_papaya_CpAGO5, 114 Brachypodium_distachyon_BdMEL1like, 115 Hordeum_vulgare_HvAGO5, 116 Oryza_sativa_OsMLE1, 117 Brachypodium_distachyon_BdMELlike, 118 Oryza_sativa_OsAGO14, 119 Vitis_vinifera_VvMEL1like, 120 Brachypodium_distachyon_BdAGO12like, 121 Oryza_sativa_OsAGO12, 122 Oryza_sativa_OsAGO11, 123 Oryza_sativa_OsAGO17, 124 Oryza_sativa_OsAGO13, 125 Brachypodium_distachyon_BdAGO18like, 126 Oryza_sativa_OsAGO18, 127 Tribolium_castaneum_TcAGO1b, 128 Tribolium_castaneum_TcAGO1a, 129 Homo_sapiens_HsAGO2, 130 Arabidopsis_lyrata_AlAGO7, 131 Arabidopsis_thaliana_AtAGO7, 132 Capsella_rubella_CrbAGO7, 133 Thellungiella_halophila_ThAGO7, 134 Brassica_rapa_BrAGO7, 135 Carica_papaya_CpAGO7, 136 Manihot_esculenta_MeAGO7b, 137 Populus_trichocarpa_PtAGO7, 138 Ricinus_communis_RcAGO7, 139 Manihot_esculenta_MeAGO7a, 140 Malus_domestica_MdAGO7b, 141 Prunus_persica_PprAGO7, 142 Vitis_vinifera_VvAGO7like, 143 Citrus_sinensis_CsnAGO7, 144 Malus_domestica_MdAGO7a, 145 Glycine_max_GmAGO7like, 146 Phaseolus_vulgaris_PvAGO7, 147 Lotus_japonicus_LjAGO7, 148 Medicago_truncatula_MtAGO7, 149 Nicotiana_attenuata_NaAGO7, 150 Eucalyptus_grandis_EgAGO7, 151 Linum_usitatissimum_LuAGO7, 152 Mimulus_guttatus_MgAGO7, 153 Brachypodium_distachyon_BdAGO7like, 154 Oryza_sativa_OsSHL4, 155 Sorghum_bicolor_SbAGO7, 156 Arabidopsis_lyrata_AlAGO3, 157 Arabidopsis_thaliana_AtAGO3, 158 Arabidopsis_lyrata_AlAGO2, 159 Arabidopsis_thaliana_AtAGO2, 160 Capsella_rubella_CrbAGO2, 161 Thellungiella_halophila_ThAGO2, 162 Brassica_rapa_BrAGO2a, 163 Brassica_rapa_BrAGO2b, 164 Capsella_rubella_CrbAGO3, 165 Carica_papaya_CpAGO2, 166 Glycine_max_GmAGO2like1, 167 Medicago_truncatula_MtAGO2, 168 Glycine_max_GmAGO2like2, 169 Medicago_truncatula_MtAGO3, 170 Vitis_vinifera_VvAGO2like, 171 Nicotiana_attenuata_NaAGO2, 172 Solanum_lycopersicum_SlAGOlike1, 173 Solanum_lycopersicum_SlAGOlike2, 174 Solanum_lycopersicum_SlAGOlike3, 175 Brachypodium_distachyon_BdAGO2like, 176 Hordeum_vulgare_HvAGO3, 177 Oryza_sativa_OsAGO2, 178 Oryza_sativa_OsAGO3, 179 Tribolium_castaneum_TcAGO2b, 180 Tribolium_castaneum_TcAGO2a, 181 Arabidopsis_lyrata_AlAGO9, 182 Capsella_rubella_CrbAGO9, 183 Arabidopsis_thaliana_AtAGO9, 184 Brassica_rapa_BrAGO9a, 185 Thellungiella_halophila_ThAGO9, 186 Brassica_rapa_BrAGO9b, 187 Brassica_rapa_BrAGO9c, 188 Arabidopsis_lyrata_AlAGO8, 189 Arabidopsis_thaliana_AtAGO8, 190 Capsella_rubella_CrbAGO8, 191 Arabidopsis_lyrata_AlAGO4, 192 Capsella_rubella_CrbAGO4, 193 Arabidopsis_thaliana_AtAGO4, 194 Brassica_rapa_BrAGO4, 195 Thellungiella_halophila_ThAGO4, 196 Carica_papaya_CpAGO4, 197 Citrus_sinensis_CsnAGO4, 198 Manihot_esculenta_MeAGO4, 199 Ricinus_communis_RcAGO4a, 200 Eucalyptus_grandis_EgAGO4a, 201 Pelargonium_hortorum_PhAGO4like, 202 Vitis_vinifera_VvAGO4, 203 Cucumis_sativus_CstAGO4, 204 Prunus_persica_PprAGO4a, 205 Mimulus_guttatus_MgAGO4, 206 Nicotiana_attenuata_NaAGO4a, 207 Nicotiana_benthamiana_NbAGO4.1, 208 Nicotiana_attenuata_NaAGO4b, 209 Nicotiana_benthamiana_NbAGO4.2, 210 Solanum_lycopersicum_SlAGO4a, 211 Glycine_max_GmAGOlike2, 212 Phaseolus_vulgaris_PvAGO9, 213 Glycine_max_GmAGO4like, 214 Phaseolus_vulgaris_PvAGO4, 215 Medicago_truncatula_MtAGO4b, 216 Medicago_truncatula_MtAGO4c, 217 Eucalyptus_grandis_EgAGO4c, 218 Eucalyptus_grandis_EgAGO4b, 219 Solanum_lycopersicum_SlAGO4b, 220 Medicago_truncatula_MtAGO4d, 221 Linum_usitatissimum_LuAGO4b, 222 Linum_usitatissimum_LuAGO4a, 223 Medicago_truncatula_MtAGO4a, 224 Populus_trichocarpa_PtAGO4b, 225 Ricinus_communis_RcAGO4b, 226 Citrus_sinensis_CsnAGO9, 227 Malus_domestica_MdAGO4, 228 Prunus_persica_PprAGO4b, 229 Populus_trichocarpa_PtAGO4a, 230 Nicotiana_attenuata_NaAGO9, 231 Brachypodium_distachyon_BdAGO4Alike, 232 Oryza_sativa_OsAGO4A, 233 Zea_mays_ZmAGO4, 234 Oryza_sativa_OsAGO4B, 235 Sorghum_bicolor_SbAGO4, 236 Brachypodium_distachyon_BdAGO4Blike, 237 Mimulus_guttatus_MgAGO9, 238 Malus_domestica_MdAGO9, 239 Thellungiella_halophila_ThAGO8, 240 Vitis_vinifera_VvAGO4Alike, 241 Glycine_max_GmAGO4Blike, 242 Arabidopsis_lyrata_AlAGO6, 243 Arabidopsis_thaliana_AtAGO6, 244 Capsella_rubella_CrbAGO6, 245 Brassica_rapa_BrAGO6, 246 Thellungiella_halophila_ThAGO6, 247 Brachypodium_distachyon_BdAGO16like, 248 Citrus_sinensis_CsnAGO6, 249 Populus_trichocarpa_PtAGO6, 250 Vitis_vinifera_VvAGO16like, 251 Ricinus_communis_RcAGO6, 252 Nicotiana_attenuata_NaAGO8, 253 Linum_usitatissimum_LuAGO9, 254 Linum_usitatissimum_LuAGO6, 255 Mimulus_guttatus_MgAGO6, 256 Glycine_max_GmAGO16like, 257 Medicago_truncatula_MtAGO6, 258 Carica_papaya_CpAGO6, 259 Medicago_truncatula_MtAGO4e, 260 Picea_glauca_PgAGO, 261 Physcomitrella_patens_PptAGOlike1, 262 Physcomitrella_patens_PptAGOlike3, 263 Physcomitrella_patens_PptAGOlike2, 264 Chlamydomonas_reinhardtii_CrnAGO6, 265 Volvox_carteri_VcAGOlike, 266 Chlamydomonas_reinhardtii_CrnAGOlike, 267 Chlamydomonas_reinhardtii_CrnAGO2like, 268 Chlamydomonas_reinhardtii_CrnAGO2, 269 Kluyveromyces_polysporus_YeastAGO, 270 Tribolium_castaneum_TcAGO3; TREE Plant_AGOs_ML = [&R] (270:1.5566146752471186,((265:0.17049453392305036,(264:0.027030467602880304,266:1.0740850346572097):0.1399051149228434):0.43184918296861596,((267:0.01894933338288407,268:1.04733278183389E-6):1.5812791371652155,(269:2.3901145321954465,(((179:0.11006646318392921,180:0.07679553142285211):1.0745911154929781,(129:0.14458665340345345,(127:1.04733278227798E-6,128:1.04733278227798E-6):0.14040733005007677):0.33497189970628805):0.18051987150521764,((((175:0.5892318279040754,(176:0.14855169017203318,(177:0.03579916772652547,178:0.38354473519478427):0.09435201236841007):0.11706660677371694):0.4334453570992465,((171:0.06622893998081691,(172:0.0589684956682861,(173:0.11998122550119827,174:0.30581221601229336):0.07229167308865092):0.0628744785473061):0.22911502652952098,((170:0.23526492320318892,((166:0.09772030242756813,167:0.10348925766879846):0.0982137699744694,(168:0.13738155253864237,169:0.13205842346054864):0.11953003000045648):0.13753323082079483):0.05130071473216624,(165:0.17543600542852822,((156:0.09248736984888195,157:0.13494067993275793):0.05273759268680189,(164:0.2734048137223102,(159:0.021262706900364137,(158:0.0056784221549275316,(160:0.03499660067117194,(161:0.07106445646381276,(162:0.04178066566086214,163:0.09417289208514656):0.013308116925534907):0.03557832714654241):0.00990223913919186):0.006485452260587277):0.048940399376010024):0.04401819409900343):0.38499632080868373):0.0749562730736626):0.0695314706145016):0.2381693751745888):0.37934868034084746,((155:0.07226503435516252,(153:0.058743512319916924,154:0.0752391544969333):0.02320173379844448):0.16771630247503833,(151:0.11229313027340027,(((149:0.09323326678350341,152:0.14865276311160303):0.018303211209425463,(133:0.023972528174882157,(134:0.06455489720917962,(132:0.03374158394903182,(130:0.015977143935048232,131:0.008860582678501316):0.005067915534310075):0.025109080843122467):0.013750389730570856):0.1886403054341832):0.020174705330185283,((135:0.05442098564945885,(137:0.03504503273643511,(138:0.030486948118388923,(136:0.03543276877438206,139:0.05322229851784055):0.014834441766006456):0.018107461269560865):0.011697943143284206):0.005641661487101324,((142:0.06946510522854599,(143:0.0642885092883847,150:0.12295289062085768):0.012375676596820373):0.006937129946969378,((141:0.024212996855936808,(140:0.02191721951056458,144:0.02441534694911507):0.01988163916452379):0.05676005582327859,((145:0.024687719613817993,146:0.02700164327407295):0.007368741350730623,(147:0.04354832703067402,148:0.05163142902035123):0.0050693154495422554):0.06707925926345393):0.00789993635080899):0.010069099594727682):0.014717202285114972):0.009121032253860406):0.05415780230087819):0.3475957641029197):0.3229638889648494,(((263:0.2420487063809631,(261:0.10208979896707282,262:0.22242604864104765):0.06060388312464049):0.4775929314356997,(260:0.24626539026684746,((247:0.20964056060625236,(255:0.1473316967733984,(252:0.1707059838761622,(250:0.08041652239737518,((249:0.0657470726736693,(251:0.11077975475955348,(253:0.1569470620423572,254:0.09327613135890944):0.09277709622694763):0.020807730322475404):0.016940022039557245,(258:0.24709773072585461,(248:0.07376524085545189,((256:0.1059521115537172,257:0.1486433970699128):0.09886402269572514,((245:0.053949403023085374,246:0.08931915167553939):0.007191630032147067,(244:0.04494226159310788,(242:0.014889232314018397,243:0.03530236343320503):0.015539731927928901):0.0392998838717844):0.23028583683263504):0.014376954963475352):0.011018386871109787):0.007208177894594936):0.023835767350309567):0.023362732682454368):0.019258653687837413):0.06273882242476425):0.07892667072551429,(((233:0.0807198014899142,(231:0.07834630506010853,232:0.0459720738948155):0.029845829216328834):0.03061315553194488,(234:0.036040744502457756,(235:0.10841228754120458,236:0.14124343386487626):0.015275438373047123):0.0653204881894558):0.09230494886766927,(((230:0.14956885784820573,240:0.2903419600207009):0.03202820430902653,((226:0.17700799121997113,(241:0.1772156014772266,259:0.2801907568016673):0.13327301670857228):0.013373787061421005,(229:0.08511918590844214,(237:0.20899757325289947,(238:0.22173930829879884,(227:0.06916251643313798,228:0.042167449535717605):0.04548162699594549):0.03180299108225704):0.022870047601058374):0.012357646712878534):0.024131409211716193):0.039645732537488154,((224:0.06111551751383537,225:0.09618876542717514):0.12681995812145086,(202:0.05489498197021936,(201:0.04808070343700255,(((217:1.04733278183389E-6,218:1.04733278183389E-6):0.11233083413518097,((221:0.019616433047955795,222:0.004148764811964689):0.09525143347706067,(205:0.08253111754507891,((219:0.12942024418055897,(206:0.0036293467953134595,207:0.012888476927052306):0.012238560942324561):0.021096832431948265,(210:0.045959204544429255,(208:0.005159579893751598,209:0.0039936706041396874):0.011213363570441892):0.05127975181560096):0.0267668372375649):0.027345451837528678):0.0176616716458895):0.017039222586776148,(((200:0.05139278516764456,203:0.0591651230071748):0.020174542928220518,(197:0.06505074154613899,(198:0.04245010571924146,199:0.06315188541210803):0.025517782849202586):0.010317170846160018):0.009083840342809957,(204:0.057574597456617305,(196:0.06809423516152391,(((211:0.037244216625981874,212:0.04504742460163724):0.07926505715292143,((213:0.03900805675420704,214:0.0671892517969308):0.019561468475114197,((215:1.04733278183389E-6,216:1.04733278183389E-6):0.023536937907564504,(220:0.06862179905094923,223:0.1599497657708655):0.02730079305845745):0.05551522951690302):0.030036427915951514):0.039894816115059406,(((194:0.027157967296311813,195:0.03856708570375167):0.02091140589325935,(192:0.01025354527213862,(191:0.006337280869574524,193:0.021464536380160215):0.007433724855673063):0.03537492126293085):0.10629787358932274,((239:0.21408998967756432,(190:0.13536855400432657,(188:0.027753034854638425,189:0.10086394888695338):0.013908348767793122):0.053495051633839275):0.06679632353353249,((182:0.012020567619412503,(181:0.0062580387298742934,183:0.03077745464381243):0.013416930573768582):0.05718275332522271,(184:0.048651472536946905,(185:0.05283730491020355,(186:0.0403040035422455,187:0.10542292422568655):0.05565781381298818):0.009903248262072673):0.029512651162773906):0.04024784168318618):0.12579378517517714):0.0324905506021933):0.018295885051911487):0.010565156235033069):0.011720924485866924):0.004613380108338561):0.009508293027632675):0.012704731165414263):0.028844541582817573):0.009612254947257703):0.03938209530703851):0.07458649219954872):0.19624337332262076):0.2931789438231225):0.40427994982412896,((125:0.20328385396057858,126:0.3666341025079971):0.33385311724595024,((((122:0.25962936138374637,(120:0.17335303647626077,121:0.11729953166054496):0.03329163921725797):0.17096676511518094,((117:0.14725653722387078,118:0.18949029446739019):0.1121191116899869,((114:0.024026093605478582,115:0.02387943140660953):0.026715369675162304,(116:1.04733278183389E-6,124:0.12295231393208095):0.00838774501202888):0.11578328714568187):0.07741659707347903):0.035722584950952374,((110:0.1749785540164046,119:0.3746781594043993):0.10194701743773171,((109:0.20431856249810432,111:0.1945155870819688):0.05931747715558977,(105:0.10388240809629723,(((103:0.06716512588574419,104:0.05288302001153955):0.10620459871972177,(100:0.05336402025936904,(101:0.11536116416132502,102:0.0952426539118747):0.02530781890641487):0.022136755354305926):0.026144907317851906,((98:0.0522238285744665,99:0.010214199426446857):0.1734783067122705,((112:0.26771998287811805,(108:0.06924187532241577,(106:0.05449698615652343,107:0.024797539813413483):0.06706168308320182):0.09658221196132999):0.03125750252728299,(113:0.27837199324949236,(96:0.057158589307941376,(97:0.0677763628821868,(95:0.10964518052724026,(93:0.013915547232934866,94:0.05191397058182723):0.029037795706936986):0.0794434003601392):0.01663587649478515):0.11771661815378565):0.03488459694175017):0.026953339028441547):0.016893205791112198):0.025505989104511517):0.035723205009936976):0.03883978417036493):0.053305695990907065):0.12335239930065267,(123:0.5870856351914799,(((51:0.017948690659907562,52:0.028448365299994727):0.02316030831451954,((43:0.0018604899680632059,(44:1.0473327813898E-6,48:0.03356398988959164):0.004446038966786858):0.009862575999529,(47:0.01079437715132947,((42:0.0608930547676767,50:0.023386201367674886):0.01369909320509688,(46:0.0036175875374055977,(45:0.004040354935630042,49:0.039394476729408545):0.0017667070516687033):0.0028390764379739863):0.0020506313352326444):0.0021476957430888177):0.007083218164917859):0.005603546277848537,(((76:0.02361168284458426,(80:0.012031041250958552,(81:0.012236248656545712,82:0.005847806772653286):0.01398654812286182):0.01544229026340549):0.023900280564665977,(77:0.03658453056181443,(78:0.030965815503744665,(79:0.030046247256586334,83:0.10614903518028385):0.007683314478123648):0.005996214227107721):0.028558456699408374):0.06527275090425189,((84:0.01652732547145508,85:0.006692183329446877):0.06030147750612347,(((62:0.0014791029261855826,63:0.07560767540321311):0.01202572725143014,((64:0.032608827270590446,(61:0.011913452654694012,91:0.1797868524324464):0.017922665851538788):0.0020009405752725584,(53:0.020891017426417413,((54:0.003824173375150508,(55:0.03304724465963638,60:0.03723605416464881):0.0022226072157662813):0.001907760252649382,(((75:0.02560654677482077,(73:0.007905020542250618,74:0.00614304194087989):0.04126617747147776):0.02248042029822095,((40:0.007324488354829128,41:0.013980941042573747):0.009630892606306674,(37:0.004801550759885309,(36:0.0045527887575600445,(38:1.04733278227798E-6,39:1.04733278227798E-6):0.02065620214167474):0.004585134208155317):0.012377352159953503):0.06181509105745597):0.012182995119371931,((56:0.01497055417146953,57:0.0021071068632485535):0.02285513627146951,(((58:0.004714282743830012,59:0.006575383938696611):0.005592824607640878,(71:0.06543181560619082,72:0.0336882997056831):0.014373906498305722):0.013287122983580701,((66:0.003691141086811456,(65:0.003717471938785799,67:1.04733278227798E-6):0.0018938538477843991):0.01613522838901371,(70:0.03737698660946975,(68:1.0473327813898E-6,69:0.00558357024515832):0.029569412173841236):0.001567093250870677):0.016350769541490173):0.0036602920242954085):0.003955739860357355):0.003575612397868966):0.0019687660104112936):0.0075191347135215025):1.0473327813898E-6):0.011119141315966807,(((89:1.0473327813898E-6,90:0.0039532111231688205):0.08792715214586178,(92:0.17271324414368472,(86:0.058307883426572005,(87:0.017337798342016875,88:0.02031738735625943):0.02000857730115424):0.0643347770370335):0.0050577159470392985):0.014457495086286798,(((26:0.015695618884948637,(22:0.03198232033270809,(24:0.011256405747962717,(23:0.0018689102225319942,25:0.009573109195282647):1.0473327813898E-6):0.0035479372754023686):0.0060734058355089715):0.04303364865347081,(35:0.07987088659318076,((28:0.10497117231686381,(33:0.024305477438075762,34:0.03172718402186714):0.03142315264740514):0.0027047837755578286,(27:0.0621864465433255,(32:0.14371894797574392,(31:0.018323519837592173,(29:0.006119256671157203,30:0.02671743456459197):0.0330463579733431):0.01519421094003981):0.04297219909134764):0.007808866708673534):0.02814477007403493):0.08615430195790186):0.030688333933211354,(11:0.01362520366814568,((17:0.023530654903042958,21:0.04643788114108638):0.009627996290317853,(8:0.00380299624817404,(10:0.01884585798167837,((9:0.01125197079963769,(7:0.01104224301910417,20:0.025748378101070557):0.004976474276128684):1.0473327813898E-6,((6:0.01913544174124393,(15:0.015236094927539412,16:0.00944288198617027):0.011440671546357528):0.0037197910674775514,((13:0.0050796665747325775,(14:0.0039521925116901,(12:1.0473327813898E-6,18:0.016910698278299385):0.0018463580790806233):0.008150032414921071):0.006467914140747766,(19:0.05070007529418774,(4:1.0473327813898E-6,(5:0.003757280059747181,(3:0.0037608024207447244,(1:1.0473327813898E-6,2:0.007548400866644656):0.0037776765293280334):0.003792543112744795):0.0037854325522017618):0.024628853765436887):0.011281263419332888):0.0036065439315100534):0.0018638057860362878):1.0473327813898E-6):0.0018040581759288798):0.003667374017947367):0.003619937283787067):0.03702064604152344):0.0902184437098601):0.032884084010690984):0.014288139071865658):0.015449007044924912):0.02320152374517903):0.04814334772476858):0.09248659518744962):0.10382147336153036):0.11787450068994687):0.07261137503201942):0.15811299673457402):0.1924699668763168):0.19999671164345267):0.1818679003824375):1.556614675247119); END;