@ARTICLE{TreeBASE2Ref18728,
author = {Pawan K Dadheech and Andreas Ballot and Peter Casper and Kiplagat Kotut and Eberto Novelo and Brook Lemma and Thomas Pr?schold and Lothar Krienitz},
title = {Phylogenetic relationship and divergence among planktonic strains of Arthrospira (Oscillatoriales, Cyanobacteria) of African, Asian and American origin deduced by 16S?23S ITS and phycocyanin operon sequences.},
year = {2010},
keywords = {Cyanobacteria, Oscillatoriales, Arthrospira, Phylogeny, Phycocyanin operon, ITS, Mexico, Africa, India},
doi = {10.2216/09-71.1},
url = {},
pmid = {},
journal = {Phycologia},
volume = {49},
number = {4},
pages = {361--372},
abstract = {Arthrospira comprises multicellular, cylindrical, usually screw-like coiled trichomes and is cultivated commercially. In this study, 33 new strains of Arthrospira isolated from plankton samples collected in Mexico, East Africa and India were investigated and compared to 53 strains or samples of earlier considerations. The study included observations of morphological features and molecular phylogenetic analyses based on nucleotide sequences of internal transcribed spacer (ITS) between 16S rRNA and 23S rRNA genes and partial sequences of beta and alpha subunits including intergenic spacer (cpcBA-IGS) of phycocyanin operon. Morphological traits of Arthrospira, such as trichome width, type of coiling and apical cell were not always consistent in culture conditions. It was revealed that Arthrospira phylogeny based on cpcBA-IGS locus was broadly comparable to the ITS region as both phylogenetic trees derived from nucleotide sequences could be divided into two main clusters. Cluster I comprised sequences from American strains mainly while cluster II contained the sequences of the strains originating from Africa and Asia chiefly. Both genetic regions of the strains investigated in the present study coincidently showed a significant sequence divergence among Arthrospira strains from East Africa, India and Mexico indicating possible distinct evolutionary lineages. }
}
Matrix 1007 of Study 10238

Citation title:
"Phylogenetic relationship and divergence among planktonic strains of Arthrospira (Oscillatoriales, Cyanobacteria) of African, Asian and American origin deduced by 16S?23S ITS and phycocyanin operon sequences.".

This study was previously identified under the legacy study ID S2594
(Status: Published).
Matrices
Title: RdRp
Description: Legacy TreeBASE Matrix ID = M2512
Rows
|
Taxon Label |
Row Segments |
Characters 1?–30 |
| MS2 Enterobacterio phage MS2 |
(none)
|
PTLGSGNDEATRRTLAIAKLREANGDRGQI |
| YFV Yellow fever virus |
(none)
|
LAVLRKVKRVVASLMRGLSSRKRRSHDVLT |
| OnuMV6 Ld Ophiostoma mitovirus 6 |
(none)
|
VKYLKELRLHITKYISGE-PYRNSLNRVSV |
| OnuMV5 Ld Ophiostoma mitovirus 5 |
(none)
|
IKYMKAVKLHITKYIANERLLSISGSRVSV |
| OnuMV4 Ld Ophiostoma mitovirus 4 |
(none)
|
IKYMKAAKLHITRYMCGKPLYSNN-ENVAL |
| ScNV 20S Saccharomyces cerevisiae narnavirus 20S RNA |
(none)
|
GVVVSRGTRSLPPSLRLFRAMTRKWLSVTA |
| ScNV 23S Saccharomyces cerevisiae narnavirus 23S RNA |
(none)
|
TGRKFPSFSVTDRPARARLAKVYRMGRRLL |
| OnuMV3a Ld Ophiostoma mitovirus 3a |
(none)
|
VQYLKECTRIVQHFVSGHPVFVTDVMPIGL |
| CpMV1 NB63 Cowpea mosaic virus |
(none)
|
FKYLKEVMRLSVRRIANIELEPSKKIFVKL |
| Qbeta Enterobacteriophage Qbeta |
(none)
|
PKFGISPDQFRNSYLRAEIMSKYDSFSLGI |
| CeMV Celery mosaic virus |
(none)
|
IKYMKSVRLHITRYICRKPLFIND-SGVSV |
| L dsRNA Sclerotinia homoeocarpa mitovirus |
(none)
|
VQYLKECTRIVQHFVSGHPVFVTDVMPIGL |
| GaMV S1 Galinsoga mosaic virus |
(none)
|
VKIFKQIRLHVTRYLCGSPLRINS-MMIGI |
| RsM2 1A1 Rhizoctonia solani virus |
(none)
|
IKWLKGCSVAIQKCLGKDILKSLRVLTPDL |
Columns
None of the columns has a description.