@ARTICLE{TreeBASE2Ref19843,
author = {Kiyotaka Takishita and Kolisko Martin and Hiroshi Komatsuzaki and Akinori Yabuki and Yuji Inagaki and Ivan Cepicka and Pavla Smejkalova and Jeffrey D Silberman and Tetsuo Hashimoto and Andrew J Roger and Alastair GB Simpson},
title = {Multigene phylogenies of diverse Carpediemonas-like organisms identify the closest relatives of ?amitochondriate? diplomonads and retortamonads},
year = {2011},
keywords = {Carpediemonas-like organisms; diplomonads; Excavata; hydrogenosomes; mitochondria; mitosomes.},
doi = {},
url = {http://},
pmid = {},
journal = {Protist},
volume = {},
number = {},
pages = {},
abstract = {Diplomonads, retortamonads, and ?Carpediemonas-like? organisms (CLOs) are a monophyletic group of protists that are microaerophilic/anaerobic and lack typical mitochondria. Most diplomonads and retortamonads are parasites, and the pathogen Giardia intestinalis is known to possess reduced mitochondrion-related organelles (mitosomes) that do not synthesize ATP. By contrast, free-living CLOs have larger organelles that superficially resemble some hydrogenosomes, organelles that in other protists are known to synthesize ATP anaerobically. This group represents an excellent system for studying the evolution of parasitism and anaerobic, mitochondrion-related organelles. Understanding these evolutionary transitions requires a well-resolved phylogeny of diplomonads, retortamonads and CLOs. Unfortunately, until now the deep relationships amongst these taxa were unresolved due to limited data for almost all of the CLO lineages. To address this, we assembled a dataset of up to six protein-coding genes that includes representatives from all six CLO lineages, and complements existing rRNA datasets. Multigene phylogenetic analyses place CLOs as well as the retortamonad Chilomastix as a paraphyletic basal assemblage to the lineage comprising diplomonads and the retortamonad Retortamonas. In particular, the CLO Dysnectes was shown to be the closest relative of the diplomonads + Retortamonas clade with strong support. This phylogeny is consistent with a drastic degeneration of mitochondrion-related organelles during the evolution from a free-living organism resembling extant CLOs to a probable parasite/commensal common ancestor of diplomonads and Retortamonas.}
}
Matrix 9472 of Study 11689

Citation title:
"Multigene phylogenies of diverse Carpediemonas-like organisms identify the closest relatives of ?amitochondriate? diplomonads and retortamonads".

Study name:
"Multigene phylogenies of diverse Carpediemonas-like organisms identify the closest relatives of ?amitochondriate? diplomonads and retortamonads".

This study is part of submission 11679
(Status: Published).
Matrices
Title: 7 genes dataset untrimmed
Description: untrimmed alignment of 6 protein codeing genes and SSU rRNA gene
Rows
Taxon Label |
Row Segments |
Characters 1?–30 |
Spironucleus barkhanus |
(none)
|
-----------------------LFCLEHG |
Kipferlia bialata NY0166 |
(none)
|
----------------------ELYCLEHG |
Chilomastix caulleryi |
(none)
|
-MREVISIHIGQAGVQIGNACWELYCLEHG |
Dysnectes brevis NY0165 |
(none)
|
------------------NACWELYCLEHG |
Carpediemonas membranifera QB |
(none)
|
-----------------------LYCLEHG |
Trimitus sp TRION |
(none)
|
-----------------------------G |
Carpediemonas sp. PCE |
(none)
|
------------------------------ |
Enteromonas hominis ENTEROII |
(none)
|
------------------------YCQEHG |
Trimastix marina |
(none)
|
-----------------------LYCLEHG |
Carpediemonas sp. NC |
(none)
|
------------------------------ |
Retortamonas sp VALE |
(none)
|
------------------------------ |
Enteromonadidae sp. PYX isolate PSEUD |
(none)
|
------------------------YCYEHG |
Hexamita inflata |
(none)
|
-----------------------LFCLEHG |
Trepomonas sp PCI |
(none)
|
---EVINIHVGQAG-VIGNACWELFCLEHG |
Carpediemonas membranifera BICM |
(none)
|
-MRECISIHIGQAGVQIGNSCWELYCLEHG |
Ergobibamus cyprinoides CL |
(none)
|
-MRECISVHIGQAGCQIGNACWELYCIEHG |
Trimastix pyriformis |
(none)
|
-MREVISIHIGQAGIQVGNACWELYCLEHG |
Carpediemonas sp. NY0171 |
(none)
|
----------------------ELYCLEHG |
Kipferlia bialata NY0173 |
(none)
|
------------------------------ |
Kipferlia bialata ppp15C |
(none)
|
------------------------------ |
Spironucleus salmonicida |
(none)
|
-----------------------LFCLEHG |
Spironucleus vortens |
(none)
|
-----------------------LYCLEHG |
Malawimonas jakobiformis |
(none)
|
-----------------------LFCLEHG |
Hicanonectes teleskopos SB |
(none)
|
-----------------------LYCLEHG |
Giardia intestinalis |
(none)
|
-MRECISVHIGQAGVQIGNACWELYCLEHG |
Enteromonas sp GECA2 |
(none)
|
-----------------------------G |
Columns
None of the columns has a description.