@ARTICLE{TreeBASE2Ref16966,
author = {Yunjung Park and Xinwen Chen and Zamir K. Punja},
title = {Molecular and biological characterization of a mitovirus in Chalara elegans (Thielaviopsis basicola)},
year = {2006},
keywords = {},
doi = {},
url = {},
pmid = {},
journal = {Phytopathology},
volume = {},
number = {},
pages = {},
abstract = {A 2.8 kb double-stranded (ds) RNA element in strain BK18 of Chalara elegans originally isolated from cotton soil in California was characterized by obtaining a full-length cDNA sequence (2,896 nucleotides in length) from a series of overlapping clones. Sequence analysis revealed the presence of one large open reading frame (ORF I) using the mitochondrial genetic code, with 20-34% amino acid identity to the ORF I of other previously reported fungal mitochondrial RNA viruses. The ORF I encoded a putative protein of 705 amino acids and contained the conserved motif characteristic of RNA-dependent RNA polymerases (RdRp). Purification of mitochondria from strain BK18 confirmed the co-localization of this dsRNA, and Northern blot hybridization with a strand-specific probe revealed the (+) single-stranded nature. This Chalara elegans mitovirus (CeMV) is designated as a new member of the Mitovirus genus of the Narnaviridae family. Using ds-RNA specific primers, the ORF I region (positions 427 to 2,544) was obtained from an additional 2.8 kb dsRNA element in strain HA2 originating from carrot roots in the Netherlands. Both ORF?s had 98% homology at the nucleotide and amino acid levels. CeMV was also found to be present in five additional strains of C. elegans from different geographic locations worldwide, and a 97-100% nucleotide sequence identity was observed within a 300 bp region of ORF I in these strains. To determine the biological effects of CeMV on C. elegans, attempts to cure strain BK18 of the dsRNA were made. Sequential transfers of mycelium at 35-37aC yielded a colony which lacked the 2.8 kb dsRNA when visualized on agarose gels and also in Northern blot hybridization analysis. However, RT-PCR with specific primer sets revealed a band, indicating that dsRNA replication had been significantly repressed (latent). The wild-type and latently-infected strains were compared for colony morphology, growth rate, melanin production, various enzymatic assays (polyphenoloxidase, laccase, tyrosinase and esterase) and virulence on carrot roots. Colony morphology on V8 agar was comparable between the two strains, while growth rate, melanin production and virulence were enhanced in the latently-infected strain. There were no detectable differences in enzymatic activity. Transmission electron microscopy of hyphae of the wild-type and latently infected strains revealed differences in the number and size of the mitochondria, which were enhanced in the latently infected strain. Our results show that CeMV is a new member of the Mitovirus group with some disruptive effects on its fungal host and is present in C. elegans strains from different locations worldwide.}
}
Matrix 1007 of Study 1458

Citation title:
"Molecular and biological characterization of a mitovirus in Chalara elegans (Thielaviopsis basicola)".

This study was previously identified under the legacy study ID S1396
(Status: Published).
Matrices
Title: RdRp
Description: Legacy TreeBASE Matrix ID = M2512
Rows
|
Taxon Label |
Row Segments |
Characters 1?–30 |
| MS2 Enterobacterio phage MS2 |
(none)
|
PTLGSGNDEATRRTLAIAKLREANGDRGQI |
| YFV Yellow fever virus |
(none)
|
LAVLRKVKRVVASLMRGLSSRKRRSHDVLT |
| OnuMV6 Ld Ophiostoma mitovirus 6 |
(none)
|
VKYLKELRLHITKYISGE-PYRNSLNRVSV |
| OnuMV5 Ld Ophiostoma mitovirus 5 |
(none)
|
IKYMKAVKLHITKYIANERLLSISGSRVSV |
| OnuMV4 Ld Ophiostoma mitovirus 4 |
(none)
|
IKYMKAAKLHITRYMCGKPLYSNN-ENVAL |
| ScNV 20S Saccharomyces cerevisiae narnavirus 20S RNA |
(none)
|
GVVVSRGTRSLPPSLRLFRAMTRKWLSVTA |
| ScNV 23S Saccharomyces cerevisiae narnavirus 23S RNA |
(none)
|
TGRKFPSFSVTDRPARARLAKVYRMGRRLL |
| OnuMV3a Ld Ophiostoma mitovirus 3a |
(none)
|
VQYLKECTRIVQHFVSGHPVFVTDVMPIGL |
| CpMV1 NB63 Cowpea mosaic virus |
(none)
|
FKYLKEVMRLSVRRIANIELEPSKKIFVKL |
| Qbeta Enterobacteriophage Qbeta |
(none)
|
PKFGISPDQFRNSYLRAEIMSKYDSFSLGI |
| CeMV Celery mosaic virus |
(none)
|
IKYMKSVRLHITRYICRKPLFIND-SGVSV |
| L dsRNA Sclerotinia homoeocarpa mitovirus |
(none)
|
VQYLKECTRIVQHFVSGHPVFVTDVMPIGL |
| GaMV S1 Galinsoga mosaic virus |
(none)
|
VKIFKQIRLHVTRYLCGSPLRINS-MMIGI |
| RsM2 1A1 Rhizoctonia solani virus |
(none)
|
IKWLKGCSVAIQKCLGKDILKSLRVLTPDL |
Columns
None of the columns has a description.