@ARTICLE{TreeBASE2Ref15456,
author = {Tracey Allen K. Freitas and Shaobin Hou and Elhadji M. Dioum and J. A. Salto and James Newhouse and Gonzalo Gonzalez and M. A. Gilles-Gonzalez and Maqsudul Alam},
title = {Ancestral hemoglobins in Archaea},
year = {2004},
keywords = {},
doi = {},
url = {},
pmid = {},
journal = {Proceedings of the National Academy of Sciences of the United States of America},
volume = {101},
number = {17},
pages = {6675--6680},
abstract = {Hemoglobins are ubiquitous in Eukarya and Bacteria but, until now, have not been found in Archaea. A phylogenetic analysis of the recently revealed microbial family of globin-coupled hemebased sensors suggests that these sensors descended from an ancient globin-only progenitor, or a protoglobin (Pgb). Here, we report the discovery and characterization of two Pgbs from the Archaea: ApPgb from the obligately aerobic hyperthermophile Aeropyrum pernix, and MaPgb from the strictly anaerobic methanogen Methanosarcina acetivorans. Both ApPgb and MaPgb bind molecular oxygen, nitric oxide, and carbon monoxide by means of a heme moiety that is coordinated to the protein through the F8 histidine (histidine 120). We postulate that these archaeal globins are the ancestors of contemporary hemoglobins. keywords: globin-coupled sensor}
}
Matrix 18587 of Study 1410

Citation title:
"Ancestral hemoglobins in Archaea".

This study was previously identified under the legacy study ID S1342
(Status: Published).
Matrices
Title: MSA OG7f
Rows
|
Taxon Label |
Row Segments |
Characters 1?–30 |
| Musa acuminata GSMUA Achr2T06610 001 |
(none)
|
MCPSIDKHWSDEEVIQLLGGRTIGDLILAN |
| Musa acuminata GSMUA Achr4T07148 001 |
(none)
|
M---ININSTDDEVVLYLEGRKVGDPTPNN |
| Musa acuminata GSMUA Achr7T26050 001 |
(none)
|
MCPSIDIHSPDEELVLFLDQRKPGDATPDN |
| Oryza sativa Os10g21560 1 |
(none)
|
MSSKISKFWSDEELVRFLAERKEAHSLPEN |
| Vitis vinifera VvNAC09 GSVIVT01009651001 |
(none)
|
MYLSISLYWSDEELFTCLQGMINGSPLPDN |
Columns
None of the columns has a description.