@ARTICLE{TreeBASE2Ref22398,
author = {xiao yun wu},
title = {The evolutionary pattern and the regulation of stearoyl-CoA desaturase genes},
year = {2013},
keywords = {Stearoyl-CoA desaturase; Evolutionary pattern; Gene duplication},
doi = {},
url = {http://},
pmid = {},
journal = {BioMed Research International},
volume = {},
number = {},
pages = {},
abstract = {Stearoyl-CoA desaturase (SCD) is a key enzyme that converts saturated fatty acids (SFAs) to monounsaturated fatty acids (MUFAs) in the biosynthesis of fat. To date, two isoforms of scd gene (scd1 and scd5) have been found widely existing in most of the vertebrate animals. However, the evolutionary patterns of both isofoms and the function of scd5 are poorly understandable. Herein, we aim to characterize the evolutionary pattern of scd genes, and further predict the function differentiation of scd genes. The sequences of scd genes were highly conserved among eukaryote. Phylogenetic analysis identified two duplications of scd gene early in vertebrate evolution. The relative rate ratio test, branch-specific dN/dS ratio tests and branch-site dN/dS ratio tests all suggested that the scd genes were evolved at a similar rate. The evolution of scd genes among eukaryote were under strictly purifying selection, though several sites in scd1 and scd5 were undergone a relax selection pressure. The variable binding sites by transcriptional factors at the 5?-UTR and by miRNAs at 3?-UTR of scd genes suggested that the regulators of scd5 may be different from that of scd1. This study promotes our understanding of the evolutionary patterns and function of SCD genes in eukaryote. }
}
Matrix 18751 of Study 14739

Citation title:
"The evolutionary pattern and the regulation of stearoyl-CoA desaturase genes".

Study name:
"The evolutionary pattern and the regulation of stearoyl-CoA desaturase genes".

This study is part of submission 14739
(Status: Published).
Matrices
Title: SCD AA
Rows
Taxon Label |
Row Segments |
Characters 1?–30 |
Caenorhabditis elegans FAT5 |
(none)
|
M----------------------TQIKVDA |
Caenorhabditis elegans FAT6 |
(none)
|
M-------------TVKTRSNIAKKIEKDG |
Caenorhabditis elegans FAT7 |
(none)
|
M-------------TVKTRASIAKKIEKD- |
Drosophila melanogaster SCD |
(none)
|
MP----PNAQAGAQSISDSLIAAASAAADA |
Mus musculus SCD1 |
(none)
|
MPAHMLQE-ISSSYTTTTTITAPPSG---N |
Rattus norvegicus SCD1 |
(none)
|
MPAHMLQEQISSSYTTTTTITEPPSGNLQN |
Tupaia belangeri SCD1 |
(none)
|
MPAHMLQDEISSSYTTTTTITAPPSRVLQN |
Macaca mulatta SCD1 |
(none)
|
MPAHLLQEDISSSYTTTTTITAPPSRVLQN |
Gorilla gorilla SCD1 |
(none)
|
MPAHLLQDDISSSYTTTTTITAPPSRVLQN |
Pan troglodytes SCD1 |
(none)
|
MPAHLLQDDISSSYTTTTTITAPPSRVLQN |
Homo sapiens SCD1 |
(none)
|
MPAHLLQDDISSSYTTTTTITAPPSRVLQN |
Tupaia belangeri SCD5 |
(none)
|
M--------PGLAADAGKVPFCDAKEEIRA |
Macaca mulatta SCD5 |
(none)
|
M--------PGPATDAGKIPFCDAKEEIRA |
Pan troglodytes SCD5 |
(none)
|
M--------PGSATDAGKIPFCDAKEEIRA |
Gorilla gorilla SCD5 |
(none)
|
M--------PGPATDAGKIPFCDAKEEIRA |
Homo sapiens SCD5 |
(none)
|
M--------PGPATDAGKIPFCDAKEEIRA |
Columns
None of the columns has a description.