CiteULike CiteULike
Delicious Delicious
Connotea Connotea

Matrix 30067 of Study 17087

About Citation title: "Transcriptomic analysis of Siberian ginseng (Eleutherococcus senticosus) to discover genes involved in saponin biosynthesis".
About Study name: "Transcriptomic analysis of Siberian ginseng (Eleutherococcus senticosus) to discover genes involved in saponin biosynthesis".
About This study is part of submission 17087 (Status: Published).

Matrices

Title: Eleutherococcus senticosus CYPs amino acid sequence

Download all Row Segment Metadata

Rows

Taxon Label Row Segments Characters 1?–30
Panax ginseng CYP716A52v2 View ----------------MEL-FYVPLLSL-F
Eleutherococcus senticosus CYP-18  (none) ----------------MQL-FYVPLLSL-F
Catharanthus roseus CYP716AL1 View ----------------MEI-FYVTLLSL-F
Medicago truncatula CYP716A12 View ----------------MEPNFYLSLLLL-F
Vitis vinifera CYP716A15 View ----------------MEV-FFLSLLLI-F
Vitis vinifera CYP716A17 View ----------------MEV-FFLSLLLI-F
Panax ginseng CYP716A53v2 View ----------------MDLFISSQLLLL-L
Panax ginseng CYP716A47 View ------------MAAAMVLFFSLSLLLLPL
Eleutherococcus senticosus CYP-17  (none) ----------------MVLFFSLSLLLL-F
Glycyrrhiza uralensis CYP88D6 View ------------MEVHWVCMSAATLLVCYI
Avena strigosa CYP51H10 View ----------------MDMTICVVWLVLAI
Arabidopsis thaliana CYP71A16 View ----------------------MEMMILIS
Arabidopsis thaliana CYP705A1 View --------------MDAIVVDSQNCFIIIL
Arabidopsis thaliana CYP705A5 View -------------MASMITVDFENCFIFLL
Glycine max CYP93E1 View ------------------MLDIKGYLVLFF
Medicago truncatula CYP93E2 View ------------------MLEIQGYVVLFL
Glycyrrhiza uralensis CYP93E3 View ------------------MLDIQGYLVLFL
Eleutherococcus senticosus CYP-03  (none) ----TTIMDGVVVYSSIVLGVGIVVG----
Medicago truncatula CYP72A61v2 View MENLGTLLSSLNLQPTKVAIITVISSVLIW
Medicago truncatula CYP72A68v2 View -------MELSWETKSAIILITVTFG--LV
Medicago truncatula CYP72A63 View -------MEVFMFPTGTTVIISVLSVLLAV
Glycyrrhiza uralensis CYP72A154 View -------MDASSTPGAIWVVLTVILAAIPI

Columns

None of the columns has a description.