@ARTICLE{TreeBASE2Ref17360,
author = {T. Sang and Daniel J. Crawford and Tod F. Stuessy and M. Silva O},
title = {ITS sequences and the phylogeny of the genus Robinsonia (Asteraceae).},
year = {1995},
keywords = {},
doi = {},
url = {http://www.jstor.org/stable/2419632},
pmid = {},
journal = {Systematic Botany},
volume = {20},
number = {},
pages = {55--64},
abstract = {Sequences from the internal transcribed spacer region (ITS) of nuclear ribosomal DNA were used to produce a hypothesis of phylogenetic relationships of six of the seven known species of Robinsonia, the second largest genus endemic to the Juan Fernandez Islands. Sequence divergence between species ranges from 0 00 to 6 77% [mean (3.65 + 2.15)%] and all sequences are the same length. One most parsimonious tree was produced from the 70 variable nucleotide sites, including the species of Senecio as outgroups; this had a consistency index of 0.92 excluding uninformative sites. The cladogram is fully concordant with one generated from morphology, with R. berteroi, the only species of subg. Rhetinodendron, as the sister taxon to the remaining species in subg. Robinsonia. Within subg. Robinsonia, sects. Eleutherolepis and Robinsonia are monophyletic. Within the former section, R. masafuerae, the only species of Robinsonia on the younger island of Masafuera, is the sister species to R. evenia, as it is in the phylogeny based on morphology. ITS sequences also provide strong support for the monophyly of Robinsonia. The average rate of ITS sequence divergence within the genus was estimated to be at least (7.83 + 0.74) x 10(-9) per site per year. Relative rate tests indicate that the molecular clock cannot be rejected for ITS sequence evolution in Robinsonia. The mode and tempo of ITS and cpDNA evolution were compared in Robinsonia and Dendroseris, the two largest endemic genera on the Juan Fernandez Islands. In both genera mean sequence divergence between species was higher in ITS than in cpDNA. The distribution of mutations in ITS and cpDNA differ between the two genera. In Dendroseris ITS sequences produced the same phylogeny as cpDNA whereas in Robinsonia, cpDNA restriction site mutations did not resolve phylogenetic relationships among the studied species while ITS sequences generated a highly resolved phylogeny,}
}
Matrix 32949 of Study 138

Citation title:
"ITS sequences and the phylogeny of the genus Robinsonia (Asteraceae).".

This study was previously identified under the legacy study ID S11x6x95c10c06c51
(Status: Published).
Matrices
Title: 11565 alignment
Rows
Taxon Label |
Row Segments |
Characters 1?–30 |
Caldanaerobacter subterraneus pacificus_EEB75482.1 |
(none)
|
------------------------------ |
Caldanaerobacter subterraneus tengcongensis_NP_624062.1 |
(none)
|
------------------------------ |
Caldanaerobacter subterraneus yonseiensis_ERM91218.1 |
(none)
|
------------------------------ |
Caldicellulosiruptor bescii YP_002573898.1 |
(none)
|
------------------------------ |
Caldicellulosiruptor hydrothermalis YP_003991814.1 |
(none)
|
------------------------------ |
Caldicellulosiruptor kronotskyensis YP_004023322.1 |
(none)
|
------------------------------ |
Thermoanaerobacter ethanolicus EGD52029.1 |
(none)
|
------------------------------ |
Thermoanaerobacter siderophilus EIW00539.1 |
(none)
|
------------------------------ |
Thermoanaerobacter siderophilus EIW00263.1 |
(none)
|
MSMPLSYEYYTTKTLCNTPGAPQKLMFVFI |
Thermoanaerobacter thermohydrosulfuricus EMT39667.1 |
(none)
|
------------------------------ |
Thermoanaerobacter wiegelii YP_004818845.1 |
(none)
|
------------------------------ |
Thermoanaerobacter wiegelii YP_004818850.1 |
(none)
|
------------------------------ |
Thermoanaerobacter wiegelii YP_004820398.1 |
(none)
|
MSMPLSYEYYTTKTLCNTPGAPQKLMFVFI |
Columns
None of the columns has a description.