@ARTICLE{TreeBASE2Ref25573,
author = {Shunmugiah Veluchamy RAMESH and Hanu R Pappu},
title = {Sequence characterization, molecular phylogeny reconstruction and recombination analysis of the Large RNA of Tomato spotted wilt virus (Tospovirus: Bunyaviridae) from the United States},
year = {2016},
keywords = {Genetic diversity, recombination, RNA dependent RNA polymerase, Tomato spotted wilt virus, Tospovirus},
doi = {10.1186/s13104-016-1999-1},
url = {http://bmcresnotes.biomedcentral.com/articles/10.1186/s13104-016-1999-1},
pmid = {},
journal = {BMC Research Notes},
volume = {9(200)},
number = {},
pages = {},
abstract = {Tomato spotted wilt virus (TSWV; Tospovirus:Bunyaviridae) has been an economically important virus in the USA for over 30 years. However the complete sequence of only one TSWV isolate PA01 characterized from pepper in Pennsylvania is available. The large (L) RNA of a TSWV WA-USA isolate was cloned and sequenced. It consisted of 8,914 nucleotides (nt) encoding a single open reading frame of 8,640 nts in the viral-complementary sense. The ORF potentially codes for RNA-dependent RNA polymerase (RdRp) of 330.9 kDa. Two untranslated regions of 241 and 33 nucleotides were present at the 5? and 3? termini, respectively that shared conserved tospoviral sequences. Phylogenetic analysis using nucleotide sequences of the complete L RNA showed that TSWV WA-USA isolate clustered with the American and Asian TSWV isolates which formed a distinct clade from Euro-Asiatic tospoviruses. Phylogeny of the amino acid sequence of all tospoviral RdRps used in this study showed that all the known TSWV isolates including the USA isolate described in this study formed a distinct and a close cluster with that of Impateins necrotic spot virus. Multiple sequence alignment revealed conserved motifs in the RdRp of TSWV. Recombination analysis identified two recombinants including the TSWV WA-USA isolate. Among them, three recombination events were detected in the conserved motifs of the RdRp. This is the first report of the complete L RNA sequence of TSWV from the USA. Sequence analysis and phylogenetic analysis of the L RNA showed distinct clustering with selected TSWV isolates reported from elsewhere. Conserved motifs in the core polymerase region of the RdRp and recombination events were identified.}
}
Matrix 35332 of Study 18894

Citation title:
"Sequence characterization, molecular phylogeny reconstruction and recombination analysis of the Large RNA of Tomato spotted wilt virus (Tospovirus: Bunyaviridae) from the United States".

Study name:
"Sequence characterization, molecular phylogeny reconstruction and recombination analysis of the Large RNA of Tomato spotted wilt virus (Tospovirus: Bunyaviridae) from the United States".

This study is part of submission 18894
(Status: Published).
Matrices
Title: Tomato spotted wilt virus RDRP Alignment
Rows
Taxon Label |
Row Segments |
Characters 1?–30 |
Tomato spotted wilt virus NP049362 Brazil |
(none)
|
MNIQKIQKLIENGTTLLLSIEDCVGSNHDL |
Tomato spotted wilt virus AEI70839 China |
(none)
|
MNIQKIQKLIENGTTLLLSIEDCVGSNHDL |
Tomato spotted wilt virus AEB33891 South Korea |
(none)
|
MNIQKIQKLIENGTTLLLSIEDCVGSNHDL |
Tomato spotted wilt virus AIA24440 Italy |
(none)
|
MNIQKIQKFIENGTTLLLSIEDCVGSNHDL |
Capsicum chlorosis virus ABB83819 Thailand |
(none)
|
MNIQTINSFLDTSGEITVYLQRIKDEIMSM |
Calla lily chlorotic spot virus ACO52399 Taiwan |
(none)
|
MNIQTINSFLDNIGEITVFLKNIKDELMSM |
Tomato zonate spot virus ABU49105 China |
(none)
|
MNIQTINSFLDNIGEITVFLKNIKDELMSM |
Melon yellow spot virus BAD06422 Japan |
(none)
|
MNIQTINSFLDISGEVTVYLQNIKDELLRM |
Iris yellow spot virus ACM89280 USA |
(none)
|
MNLQSVHSSLDITDRINVFLNDLRDKLMNL |
Hippeastrum chlorotic ringspot virus CDJ79757 China |
(none)
|
MNLQNVHSFLEITGQITVFLNELREKLMIL |
Bean necrotic mosaic virus YP006468898 Brazil |
(none)
|
MNEQTILTLVNFSNEILEKIKICRDRLNTY |
Soybean vein necrosis virus ADX96062 USA |
(none)
|
MNDQTIITLVNFNNEILEKIKICRDRLNTY |
Impatiens necrotic spot virus ABD93455 Italy |
(none)
|
MNNYKARLLIENSVTLLSSIDDCIKSNLEL |
Tomato spotted wilt virus BAD86755 Japan |
(none)
|
MNIQKIQKLIENGTTLLLSIEDCVGSNHDL |
Watermelon silver mottle virus AF133128 Taiwan |
(none)
|
MNIQTINSFLDTSGEITVYLQAIKDEIMLM |
Peanut bud necrosis virus AF025538 USA |
(none)
|
MNIQTINNFLDTSGEITVYLRSIKDEIMSM |
Tomato spotted wilt virus KT160280PA01 USA |
(none)
|
MNIQKIQKLIENGTTLLLSIEDCVGSNHDL |
Tomato spotted wilt virus KP827649 WA USAb |
(none)
|
MNIQKIQKLIENGTTLLLSIEDCVGSNHDL |
La Crosse virus ABQ12635LCV USA |
(none)
|
M----------------------------- |
Columns
None of the columns has a description.