CiteULike CiteULike
Delicious Delicious
Connotea Connotea

Matrix 38906 of Study 20144

About Citation title: "Functional characterization of thiolase-encoding genes from Xanthophyllomyces dendrorhous and their effects on carotenoid synthesis".
About Study name: "Functional characterization of thiolase-encoding genes from Xanthophyllomyces dendrorhous and their effects on carotenoid synthesis".
About This study is part of submission 20144 (Status: Published).

Matrices

Title: Thiolase alignment

Description: Protein sequence alignment for differentially located thiolases

Rows

Taxon Label Row Segments Characters 1?–30
Arabidopsis thaliana cytoplasmic ACAT  (none) -----------------------------M
Blumeria graminis cytoplasmic ACAT  (none) ------------------------------
Bos taurus mitochondrial ACAA  (none) ------------------------------
Bos taurus mitochondrial ACAT  (none) MPVLAALLR-----------RGPLLQRRVQ
Bos taurus peroxisomal ACAA  (none) ----------MRRLQVVLGHLKGRPASDPE
Canis lupus familiaris mitochondrial ACAT  (none) MGTCILDLPPGKTSGVVENARARLVRRVCQ
Canis lupus familiaris peroxisomal ACAA  (none) ----------MRRLQVVLGHLSGQPPSDGA
Equus caballus peroxisomal ACAA  (none) ----------MQRLQVVLGHLKGRPHSGPE
Gallus gallus mitochondrial ACAT  (none) MAAVAMLGR------------RRAAAGLLR
Gallus gallus peroxisomal ACAA  (none) MAALQPGGGAARRVRAVLGHLSG-PGAGAV
Homo sapiens mitochondrial ACAT  (none) MAVLAALLRSGARS------RSPLLRRLVQ
Homo sapiens peroxisomal ACAA  (none) ----------MQRLQVVLGHLRGPADSGWM
Mus musculus mitochondrial ACAA  (none) ------------------------------
Mus musculus peroxisomal ACAA  (none) ----------MHRLQVVLGHLAGRPESSSA
Nicotiana tabacum cytoplasmic ACAT  (none) ------------------------------
Rattus norvegicus mitochondrial ACAA  (none) ------------------------------
Rattus norvegicus mitochondrial ACAT  (none) MAALAVLHG---------VVRRPLLRGLLQ
Saccharomyces cerevisiae cytoplasmic ACAT  (none) ------------------------------
Saccharomyces cerevisiae peroxisomal ACAA  (none) ---------MSQRLQSIKDHLVESAMG---
Schizosaccharomyces pombe cytoplasmic ACAT  (none) ------------------------------
Xanthophyllomyces dendrorhous ERG10A  (none) MSAAFRLTT---------IKIHLLPVFSIR
Xanthophyllomyces dendrorhous ERG10B  (none) ------------------------------
Yarrowia lypolitica peroxisomal ACAA  (none) ----------MDRLNNLATQLEQ-------
Zea mays cytoplasmic ACAT  (none) ------------------------------

Columns

None of the columns has a description.