@ARTICLE{TreeBASE2Ref26528,
author = {Nicole Andrea Werner and Melissa Katherine Gomez and Marcelo Baeza and Victor Cifuentes and Jennifer Alcaino},
title = {Functional characterization of thiolase-encoding genes from Xanthophyllomyces dendrorhous and their effects on carotenoid synthesis},
year = {2016},
keywords = {Thiolase, mevalonate, astaxanthin, sterols, carotenoids, functional complementation},
doi = {10.1186/s12866-016-0893-2},
url = {http://bmcmicrobiol.biomedcentral.com/articles/10.1186/s12866-016-0893-2},
pmid = {},
journal = {BMC Microbiology},
volume = {16},
number = {1},
pages = {},
abstract = {Background: The basidiomycetous yeast Xanthophyllomyces dendrorhous has been described as a potential biofactory for terpenoid-derived compounds due to its ability to synthesize astaxanthin. Functional knowledge of the genes involved in terpenoid synthesis would create opportunities to enhance carotenoid production. A thiolase enzyme catalyzes the first step in terpenoid synthesis.
Results: Two potential thiolase-encoding genes were found in the yeast genome; bioinformatically, one was identified as an acetyl-CoA C-acetyltransferase (ERG10), and the other was identified as a 3-ketoacyl Co-A thiolase (POT1). Heterologous complementation assays in Saccharomyces cerevisiae showed that the ERG10 gene from X. dendrorhous could complement the lack of the endogenous ERG10 gene in S. cerevisiae, thereby allowing cellular growth and sterol synthesis. X. dendrorhous heterozygous mutants for each gene were created, and a homozygous POT1 mutant was also obtained. This mutant exhibited changes in pigment composition and higher ERG10 transcript levels than the wild type strain.
Conclusions: The results support the notion that the ERG10 gene in X. dendrorhous is a functional acetyl-CoA C-acetyltransferase essential for the synthesis of mevalonate in yeast. The POT1 gene would encode a functional 3-ketoacyl Co-A thiolase that is non-essential for cell growth, but its mutation indirectly affects pigment production.
}
}
Matrix 38906 of Study 20144

Citation title:
"Functional characterization of thiolase-encoding genes from Xanthophyllomyces dendrorhous and their effects on carotenoid synthesis".

Study name:
"Functional characterization of thiolase-encoding genes from Xanthophyllomyces dendrorhous and their effects on carotenoid synthesis".

This study is part of submission 20144
(Status: Published).
Matrices
Title: Thiolase alignment
Description: Protein sequence alignment for differentially located thiolases
Rows
Taxon Label |
Row Segments |
Characters 1?–30 |
Arabidopsis thaliana cytoplasmic ACAT |
(none)
|
-----------------------------M |
Blumeria graminis cytoplasmic ACAT |
(none)
|
------------------------------ |
Bos taurus mitochondrial ACAA |
(none)
|
------------------------------ |
Bos taurus mitochondrial ACAT |
(none)
|
MPVLAALLR-----------RGPLLQRRVQ |
Bos taurus peroxisomal ACAA |
(none)
|
----------MRRLQVVLGHLKGRPASDPE |
Canis lupus familiaris mitochondrial ACAT |
(none)
|
MGTCILDLPPGKTSGVVENARARLVRRVCQ |
Canis lupus familiaris peroxisomal ACAA |
(none)
|
----------MRRLQVVLGHLSGQPPSDGA |
Equus caballus peroxisomal ACAA |
(none)
|
----------MQRLQVVLGHLKGRPHSGPE |
Gallus gallus mitochondrial ACAT |
(none)
|
MAAVAMLGR------------RRAAAGLLR |
Gallus gallus peroxisomal ACAA |
(none)
|
MAALQPGGGAARRVRAVLGHLSG-PGAGAV |
Homo sapiens mitochondrial ACAT |
(none)
|
MAVLAALLRSGARS------RSPLLRRLVQ |
Homo sapiens peroxisomal ACAA |
(none)
|
----------MQRLQVVLGHLRGPADSGWM |
Mus musculus mitochondrial ACAA |
(none)
|
------------------------------ |
Mus musculus peroxisomal ACAA |
(none)
|
----------MHRLQVVLGHLAGRPESSSA |
Nicotiana tabacum cytoplasmic ACAT |
(none)
|
------------------------------ |
Rattus norvegicus mitochondrial ACAA |
(none)
|
------------------------------ |
Rattus norvegicus mitochondrial ACAT |
(none)
|
MAALAVLHG---------VVRRPLLRGLLQ |
Saccharomyces cerevisiae cytoplasmic ACAT |
(none)
|
------------------------------ |
Saccharomyces cerevisiae peroxisomal ACAA |
(none)
|
---------MSQRLQSIKDHLVESAMG--- |
Schizosaccharomyces pombe cytoplasmic ACAT |
(none)
|
------------------------------ |
Xanthophyllomyces dendrorhous ERG10A |
(none)
|
MSAAFRLTT---------IKIHLLPVFSIR |
Xanthophyllomyces dendrorhous ERG10B |
(none)
|
------------------------------ |
Yarrowia lypolitica peroxisomal ACAA |
(none)
|
----------MDRLNNLATQLEQ------- |
Zea mays cytoplasmic ACAT |
(none)
|
------------------------------ |
Columns
None of the columns has a description.