@ARTICLE{TreeBASE2Ref30781,
author = {Beom-Soon Choi and Young Hwan Lee and Hee-Jin Kim and Atsushi Hagiwara and Jae-Seong Lee},
title = {Complete mitochondrial DNA of the marine water flea Diaphanosoma celebensis (Cladocera, Sididae)},
year = {2020},
keywords = {Mitochondria, Diaphanosoma celebensis},
doi = {10.1080/23802359.2020.1772138},
url = {},
pmid = {},
journal = {Mitochondrial DNA Part B},
volume = {5},
number = {3},
pages = {2254--2255},
abstract = {The complete mitochondrial genome was sequenced from the marine water flea Diaphanosoma celebensis. The sequenced mitochondrial genome size was 17,060 bp, possessing identical gene order of 13 protein-coding genes (PGCs) to those of the congeneric freshwater species Diaphanosoma dubium in the genus Diaphanosoma. The mitochondrial genome of D. celebensis had 13 PGCs, two rRNAs, and 22 tRNAs. Of 13 PGCs, three genes (CO3, ND3, and ND4) had incomplete stop codons. Furthermore, the stop codons of the remaining ten PGCs were TAA (for CO1, ATP8, ATP6, ND5, ND6, and ND1) and TAG (for NL4L, Cytb, and ND2). The second and third base composition of codon on 9 PCGs on the L strand in D. celebensis mitogenome showed an anti-G bias (11.0% and 15.0%), respectively.}
}
Matrix 54389 of Study 26222

Citation title:
"Complete mitochondrial DNA of the marine water flea Diaphanosoma celebensis (Cladocera, Sididae)".

Study name:
"Complete mitochondrial DNA of the marine water flea Diaphanosoma celebensis (Cladocera, Sididae)".

This study is part of submission 26222
(Status: Published).
Matrices
Title: Diaphanosoma celebensis
Description: ClustalW
Download all Row Segment Metadata
Rows
|
Taxon Label |
Row Segments |
Characters 1?–30 |
| Diaphanosoma celebensis |
View
|
MVLLRRWLYSTNHKDIGTLYFIFGVWSGMV |
| Diaphanosoma dubium |
(none)
|
---MRRWLYSTNHKDIGTLYFIFGAWAGMV |
| Diaphanosoma excisum |
(none)
|
------------------------------ |
| Diaphanosoma lacustris |
(none)
|
------------------------------ |
| Daphnia magna |
(none)
|
---MRRWLFSTNHKDIGTLYFVFGVWSGMV |
| Diaphanosoma mongolianum |
(none)
|
------------------------------ |
| Diaphanosoma orghidani |
(none)
|
------------------------------ |
Columns
None of the columns has a description.