@ARTICLE{TreeBASE2Ref20266,
author = {Polina Perelman and Warren E Johnson and Christian Roos and Hector N Seu?́nez and Julie E Horvath and Miguel A. M. Moreira and B D Kessing and Joan Pontius and Melody Roelke and Yves Rumpler and Maria Paula C Schneider and Artur Silva and Stephen J. O'Brien and Jill Pecon-Slattery},
title = {A Molecular Phylogeny of Living Primates.},
year = {2011},
keywords = {},
doi = {10.1371/journal.pgen.1001342},
url = {http://},
pmid = {},
journal = {PLoS Genetics},
volume = {7},
number = {3},
pages = {e1001342},
abstract = {Comparative genomic analyses of primates offer considerable potential to define and understand the processes that mold, shape, and transform the human genome. However, primate taxonomy is both complex and controversial, with marginal unifying consensus of the evolutionary hierarchy of extant primate species. Here we provide new genomic sequence (,8 Mb) from 186 primates representing 61 (,90%) of the described genera, and we include outgroup species from Dermoptera, Scandentia, and Lagomorpha. The resultant phylogeny is exceptionally robust and illuminates events in primate evolution from ancient to recent, clarifying numerous taxonomic controversies and providing new data on human evolution. Ongoing speciation, reticulate evolution, ancient relic lineages, unequal rates of evolution, and disparate distributions of insertions/deletions among the reconstructed primate lineages are uncovered. Our resolution of the primate phylogeny provides an essential evolutionary framework with far-reaching applications including: human selection and adaptation, global emergence of zoonotic diseases, mammalian comparative genomics, primate taxonomy, and conservation of endangered species.}
}
Matrix 38271 of Study 12186
Citation title:
"A Molecular Phylogeny of Living Primates.".
Study name:
"A Molecular Phylogeny of Living Primates.".
This study is part of submission 12186
(Status: Published).
Matrices
Title: Myoblast determination protein 1
Rows
|
Taxon Label |
Row Segments |
Characters 1?–30 |
| Caenorhabditis elegans MyoD |
(none)
|
MNTETSTQSAPSDTYDTSIYYNSSPRVTAN |
| Takifugu rubripes MyoD2 |
(none)
|
------------------------------ |
| Sparus aurata MyoD2 |
(none)
|
------------------------------ |
| Oryzias latipes MyoD1 |
(none)
|
------------------------------ |
| Takifugu rubripes MyoD1 |
(none)
|
------------------------------ |
| Mus musculus MyoD |
(none)
|
-------------------MELLSPPLRDI |
| Homo sapiens MyoD |
(none)
|
-------------------MELLSPPLRDV |
| Oncorhynchus mykiss MyoD1a |
(none)
|
-----------------------------M |
| Salmo salar MyoD1a |
(none)
|
-----------------------------M |
| Salmo salar MyoD1c |
(none)
|
-----------------------------M |
| Oncorhynchus mykiss MyoD1c |
(none)
|
-----------------------------M |
| Salmo salar MyoD1b |
(none)
|
-----------------------------M |
| Oncorhynchus mykiss MyoD1b |
(none)
|
-----------------------------M |
| Xenopus laevis MyoD |
(none)
|
-------------------MELLPPPLRDM |
| Gallus gallus MyoD |
(none)
|
-------------------MD----LLGPM |
| Anolis carolinensis MyoD |
(none)
|
-------------------ME----VLGPM |
Columns
None of the columns has a description.
Go to search
Citation
Taxa
Matrices
Trees
Analyses
